Osmia bicornis bicornis (red mason bee): 114879079 Help Entry 114879079         CDS       T06109                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism obb  Osmia bicornis bicornis (red mason bee) Pathway obb04070   Phosphatidylinositol signaling system obb04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:obb00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     114879079  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     114879079  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:obb01009]     114879079   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:obb04131]     114879079    03036 Chromosome and associated proteins [BR:obb03036]     114879079   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:obb04147]     114879079 Protein phosphatases and associated proteins [BR:obb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114879079 Membrane trafficking [BR:obb04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114879079 Chromosome and associated proteins [BR:obb03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114879079 Exosome [BR:obb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114879079 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin SPEF2_C DUF5580_M FCaBP_EF-hand TerB MotA_activ Fe_hyd_lg_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  114879079 NCBI-ProteinID:  XP_029049447 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MNLFFCLKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI NEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL GEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgaacctttttttttgtttaaaggctgatcaactcacagaagagcaaattgcagaattt aaggaagcattttcgctatttgacaaagatggagatggtaccattacaaccaaagagttg ggtacagttatgcgatcgctaggtcaaaatcctacagaagcagagcttcaggatatgatc aatgaagtggatgcagatggtaatggcacaatcgattttccggaattcttaaccatgatg gctcgcaaaatgaaggatactgacagtgaggaggaaattagggaggccttcagagtattt gataaggatggaaatggtttcatatctgcagcggaactcagacatgttatgacaaatctt ggcgagaaactcactgatgaggaagtagatgagatgattcgggaggctgacattgatggt gatggccaagtgaattatgaagaatttgtcacaatgatgacatcaaagtga

DBGET integrated database retrieval system