Osmia bicornis bicornis (red mason bee): 114879249 Help Entry 114879249         CDS       T06109                                  Name (RefSeq) autophagy protein 12-like   KO K08336   ubiquitin-like protein ATG12 Organism obb  Osmia bicornis bicornis (red mason bee) Pathway obb04068   FoxO signaling pathway obb04136   Autophagy - other obb04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:obb00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     114879249  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114879249    04136 Autophagy - other     114879249  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:obb04131]     114879249    04121 Ubiquitin system [BR:obb04121]     114879249    03029 Mitochondrial biogenesis [BR:obb03029]     114879249 Membrane trafficking [BR:obb04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     114879249 Ubiquitin system [BR:obb04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    114879249 Mitochondrial biogenesis [BR:obb03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     114879249 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 RRM_8 Motif Other DBs NCBI-GeneID:  114879249 NCBI-ProteinID:  XP_029049845 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MSDKGGNESVTTNEIVDKSEETGENLTNEEAPTSLETIPSETPLVRNGTQTASKDKTKID ILLKATANAPIMKQKRWTVSQDQCIGKISDFVRRYLKLDSNEKLFLYVNQTFAPAPDQVV KNLYNCYGADGKLILHYCKSQAWG NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaaggaggaaacgaatctgtcactaccaatgaaattgttgacaagtctgaa gaaacgggagaaaatttaacaaacgaagaagcacccacgagcctcgagactattccttct gaaacacctttggttcgaaatggaactcagactgcttccaaagacaaaacaaaaatcgat attttattaaaagcaaccgctaatgctccgataatgaaacagaagagatggactgtcagt caagatcagtgtatcggtaaaatttctgatttcgtgagaagatacctgaaactagattct aacgaaaaattgtttctttatgtaaatcaaacatttgcacctgcgccggatcaagtggtg aaaaatttatacaactgttatggagccgacgggaaactaatacttcactattgtaaaagt caagcgtggggctaa

DBGET integrated database retrieval system