Osmia bicornis bicornis (red mason bee): 114880156 Help Entry 114880156         CDS       T06109                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism obb  Osmia bicornis bicornis (red mason bee) Pathway obb03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:obb00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     114880156  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:obb03036]     114880156   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:obb04147]     114880156 Chromosome and associated proteins [BR:obb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114880156 Exosome [BR:obb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114880156 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  114880156 NCBI-ProteinID:  XP_029051688 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MSGRGKGGKTKGKAKSRSNRAGLQFPVGRIHRLLRKGNFAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKS DKKA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaaaggtggaaaaactaagggaaaggcaaagtctcgttctaatcgt gctggactgcaatttcctgttggtcgtattcatagacttcttcggaaaggaaatttcgca gaacgtgttggtgccggagctccagtatatcttgctgctgtaatggaatatttggcagct gaagtattggaattagctggtaacgctgctcgtgataataaaaagaccaggattattcct cgtcatcttcaactggccattcgtaatgacgaagaattgaataaattactttctggcgtt actattgctcaaggtggtgtattaccaaacattcaggcagtgttgttgccaaagaaatca gacaagaaagcataa

DBGET integrated database retrieval system