KEGG   Ooceraea biroi (clonal raider ant): 105280349
Entry
105280349         CDS       T05778                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105280349
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:obo00199]
    105280349
Enzymes [BR:obo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105280349
Cytochrome P450 [BR:obo00199]
 Cytochrome P450, animal type
  CYP306 family
   105280349
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105280349
NCBI-ProteinID: XP_011339142
LinkDB
Position
1:3011217..3026661
AA seq 519 aa
MIHIILSASLISFIYFLFAYCKNRKTLRLPPGPSGVPILGYLPWIDPERPHLSLTNLARK
YGPICGLRMGSVYTILLSDPQLVRQAFAKDAFAGRAPLYLTHGIMQGYGLIGAEGDLWKD
QRRFVAGCLKNFGMMKLPGTRRDKMEERILATVDECISKLKSRIEADGIDPLETLHHCVG
NLLNDLVFGKVYEENDEVWKWLRHLQEEGVKHIGVAGPLNFFPFLRFLPRYGKIMTSLVD
GKLKTHHLYQTIIDEHRARPQKTDSFLAAFDDAMRTNADNPGYFTQPQFYHLLADLFGAG
TDTTLTTFRWFMLFMATHPEEQRKIQDEMNELLGTKLPRLEDKHVLIRLEAAIMETQRLR
SITPLGIPHGTIQDTQLGDYDVPKGTMVVPLQWAIHTDPAHWHDPLSFKPERFIAEDGSL
AKPKAFLPYQTGKLTGKNGMSEVELRRLISRKYCCFMRHEGKRMCVGDELAKMMLFLLAA
RMLHSFAISLPTDAQIDLEGECGITLVPKPHRLIFMPRE
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgatacacatcatcctcagtgcatccctcatatcttttatttattttttatttgcctac
tgcaaaaatcgtaagacgctccgcctccctccgggaccatctggcgtcccgatcctcggg
tatttaccatggatagatcccgaacgtcctcacctgtcgctgacgaatctggcgaggaag
tacggcccgatttgtggactacgaatgggctcggtgtacacgatcttattgtcggatcct
cagctggtaaggcaggcctttgccaaggatgcgtttgccggtagggcaccgctctattta
acgcacggcatcatgcaggggtacggtctcatcggcgccgagggtgacctttggaaggac
cagaggaggttcgtggccggatgcctgaagaatttcggcatgatgaagctgcccggtacc
agaagagacaagatggaggagagaatcctcgcgaccgtggacgagtgcatatcgaaactg
aagagtcgcatcgaggcagacggtatcgacccgctggagacgcttcatcactgcgtgggc
aatctgctgaacgacctcgtgttcggcaaagtttacgaggagaacgacgaggtgtggaag
tggctcaggcacttgcaggaggaaggagtcaagcatatcggagtcgcaggaccgctcaac
ttttttccgtttctcagatttttaccacgatacgggaagataatgacgtcactcgtcgat
ggcaagctgaaaactcatcacctgtatcaaaccattatcgatgagcaccgtgcccgacct
cagaagacagacagtttcctggcagctttcgacgatgcaatgaggaccaacgcggacaat
cctgggtatttcacgcaaccgcaattctatcatttgctggccgatcttttcggcgcgggc
acagacaccactctgacgacttttcgttggttcatgctcttcatggcgacgcatccggaa
gaacaaagaaaaattcaggatgaaatgaacgaacttttgggaacgaaattacccaggctg
gaggacaagcacgtattgattcgactggaagcggcaatcatggagacgcagagattgcga
agtattacgccgctcggcatccctcacggtacaatacaggacactcagctaggcgattac
gatgtaccgaaaggcaccatggtcgtaccgttgcaatgggcgattcatacggatcctgct
cactggcacgacccgctctcctttaaaccggaaagatttattgccgaggatgggagtctc
gccaagccgaaagcttttctgccatatcagacgggtaagctgacaggaaaaaatggaatg
tcagaggtagagcttcgtcgtctcatatcgcgcaaatattgttgtttcatgcgacacgaa
ggcaaacgtatgtgcgtcggtgatgaactggccaagatgatgctgttcctgctcgccgcg
agaatgcttcactcgttcgctatctcgttgccaaccgatgcgcagatcgatctggaaggc
gaatgcggaattaccctggtcccgaaaccgcatcgattgatttttatgccgcgggaataa

DBGET integrated database retrieval system