Oryza brachyantha (malo sina): 102702287 Help Entry 102702287         CDS       T02995                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism obr  Oryza brachyantha (malo sina) Pathway obr03018   RNA degradation obr03040   Spliceosome Brite KEGG Orthology (KO) [BR:obr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     102702287   09123 Folding, sorting and degradation    03018 RNA degradation     102702287  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:obr03019]     102702287    03041 Spliceosome [BR:obr03041]     102702287 Messenger RNA biogenesis [BR:obr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      102702287   mRNA degradation factors    5'-3' decay     Lsm complex      102702287 Spliceosome [BR:obr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     102702287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  102702287 NCBI-ProteinID:  XP_006654882 UniProt:  J3MAD5 LinkDB All DBs Position 5:20071365..20073427 Genome browser AA seq 99 aa AA seqDB search MASGGPGLESLVDQIISVITNDGRNIVGTLRGFDQATNIILDESHERVYSTKEGVQQLVL GLYIIRGDNISVVGEVDEELDARLDLSKLRAHPLKPVIH NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcgtccggcgggccggggctcgaatcgctcgtcgaccagatcatatccgtcatcaca aacgatggccgcaacattgtgggcacgctcaggggattcgatcaagccaccaacatcatc ctcgatgagtcccatgagagggtctactctaccaaggagggagtgcaacagcttgttctt gggctgtacattataaggggcgacaacatcagcgtggtgggggaggtggatgaagagctg gatgcgaggctggacctgtcgaagctgagagcgcatccgctgaagcctgtgatccactga

DBGET integrated database retrieval system