Oryza brachyantha (malo sina): 102703969 Help Entry 102703969         CDS       T02995                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism obr  Oryza brachyantha (malo sina) Pathway obr04145   Phagosome obr04148   Efferocytosis obr04620   Toll-like receptor signaling pathway obr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:obr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102703969    04148 Efferocytosis     102703969  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102703969  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102703969  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:obr04131]     102703969   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:obr04147]     102703969    04031 GTP-binding proteins [BR:obr04031]     102703969 Membrane trafficking [BR:obr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     102703969  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     102703969   Macropinocytosis    Ras GTPases     102703969  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     102703969 Exosome [BR:obr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102703969   Exosomal proteins of other body fluids (saliva and urine)    102703969   Exosomal proteins of colorectal cancer cells    102703969   Exosomal proteins of bladder cancer cells    102703969 GTP-binding proteins [BR:obr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     102703969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  102703969 NCBI-ProteinID:  XP_006654640 UniProt:  J3M8U2 LinkDB All DBs Position 5:16884643..16887108 Genome browser AA seq 215 aa AA seqDB search MSGATKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLW DTAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTK LDLRDHRSYLADHPAASAITTAQGEELRKQIGAAAYIECSSKTQQNIKAVFDTAIKVVLQ PPRRRGEATMARKKTRRSSGGCSLKNLMCGSTCVV NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcggcgcgaccaagttcatcaagtgcgtcacggtgggggacggcgcggtgggcaag acctgcatgctcatctgctacaccagcaacaagttccccaccgattacatccccacggtg ttcgacaacttcagtgccaatgtttcagtggatgggaacattgtgaacctgggattatgg gacactgctgggcaagaggattacagcaggctgaggccactgagctacaggggagctgat atatttgtgctggcattctcattgatcagcagagcaagctatgagaatgttcttaagaag tggatgccggagcttcgccggtttgcgccgaatgttccaattgttcttgttgggaccaag ttagatctacgtgaccacagatcttaccttgctgaccatcctgcagcttcagcaatcaca actgcacagggtgaagaacttaggaagcagataggtgcggcagcttacattgaatgcagt tcgaaaacacagcagaacatcaaggccgtgtttgatactgccatcaaggtggtccttcag ccacctcggagaaggggcgaggcgacgatggcaaggaagaagacaaggcgaagctccggg ggatgctcattaaaaaacttgatgtgtggcagtacttgtgttgtctag

DBGET integrated database retrieval system