Oryza brachyantha (malo sina): 102709348 Help Entry 102709348         CDS       T02995                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism obr  Oryza brachyantha (malo sina) Pathway obr04016   MAPK signaling pathway - plant obr04070   Phosphatidylinositol signaling system obr04075   Plant hormone signal transduction obr04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:obr00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     102709348    04070 Phosphatidylinositol signaling system     102709348    04075 Plant hormone signal transduction     102709348  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     102709348  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:obr01009]     102709348   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:obr04131]     102709348    03036 Chromosome and associated proteins [BR:obr03036]     102709348   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:obr04147]     102709348 Protein phosphatases and associated proteins [BR:obr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102709348 Membrane trafficking [BR:obr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102709348 Chromosome and associated proteins [BR:obr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102709348 Exosome [BR:obr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102709348 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 SAPC2_N DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen EF-hand_EFHB_C Caleosin MotA_activ FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  102709348 NCBI-ProteinID:  XP_006649997 UniProt:  J3LN93 LinkDB All DBs Position 3:9923452..9925232 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc gacaaggacggcgacggttgcatcacaaccaaggagctgggaaccgtgatgcgttcgctg gggcagaacccaacggaggccgagctccaggacatgatcaacgaggtggacgccgatggc aacggcaccatcgacttcccggagttcctcaacctgatggcccgcaagatgaaggacact gactcggaggaggagctcaaggaggcgttcagggtgttcgacaaggaccagaacggcttc atctccgccgcggagctccgccacgtcatgaccaacctcggcgagaagctgaccgacgag gaggtcgatgagatgatccgtgaggccgacgtcgacggcgatggccagatcaactacgag gagttcgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system