Oryza brachyantha (malo sina): 102719223 Help Entry 102719223         CDS       T02995                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism obr  Oryza brachyantha (malo sina) Pathway obr03083   Polycomb repressive complex obr04120   Ubiquitin mediated proteolysis obr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:obr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102719223    04120 Ubiquitin mediated proteolysis     102719223   09126 Chromosome    03083 Polycomb repressive complex     102719223  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:obr04131]     102719223    04121 Ubiquitin system [BR:obr04121]     102719223    03036 Chromosome and associated proteins [BR:obr03036]     102719223 Membrane trafficking [BR:obr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     102719223 Ubiquitin system [BR:obr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      102719223    Cul7 complex      102719223 Chromosome and associated proteins [BR:obr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      102719223   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      102719223 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ DUF927 FrhB_FdhB_N Motif Other DBs NCBI-GeneID:  102719223 NCBI-ProteinID:  XP_006658847 UniProt:  J3MN58 LinkDB All DBs Position 7:16649705..16650617 Genome browser AA seq 152 aa AA seqDB search MITLKCSDGELIEVRAASAMLSKILGEMVESGHADGVIPLTEIDSKTFKKVIKYCDKHAD FAANNKSGTDEEKDWDKGFIDELDKNRNFLFCVIMAANFLCIRGLLEDGCQKVADTIKGK TPEEIREAFNIENDLTAEDLKEISLENEKVFG NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgatcaccctcaagtgcagtgatggcgagctgatcgaggtgagggcggcgtcggcgatg ctgtccaaaatcctcggggaaatggtcgagtccggccacgccgatggagtcatcccgctc acggagatcgactccaagaccttcaagaaggtgatcaagtactgcgacaagcacgccgac ttcgccgccaacaacaagtccggtaccgacgaggagaaagactgggacaagggcttcatc gacgagctggacaagaacaggaacttcctcttctgcgtcatcatggccgccaacttcctc tgcatccgtggactcctcgaagacggctgccagaaggtcgccgacacgatcaagggcaag acccccgaggagatccgcgaggctttcaacatcgagaacgacctcaccgctgaggacttg aaggagataagcctggagaacgaaaaggtcttcgggtag

DBGET integrated database retrieval system