Opitutaceae bacterium TAV5: OPIT5_05530 Help Entry OPIT5_05530       CDS       T03683                                  Name (GenBank) preprotein translocase TatA   KO K03116   sec-independent protein translocase protein TatA Organism obt  Opitutaceae bacterium TAV5 Pathway obt03060   Protein export obt03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:obt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     OPIT5_05530  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     OPIT5_05530  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:obt02044]     OPIT5_05530 Secretion system [BR:obt02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    OPIT5_05530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E TraS Motif Other DBs NCBI-ProteinID:  AHF89772 UniProt:  W0IUI2 LinkDB All DBs Position complement(1182257..1182523) Genome browser AA seq 88 aa AA seqDB search MTLDLPLLAGFMGIGGTELIVILVIVLLLFGGAKLPALARGLGQSIKEFKKAQVMDEDDD DDEDGNDRKKKTGSPKLASTSKKAPSDN NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgactcttgatctccccctcctcgcagggtttatgggcatcggcggtaccgagctgatt gtcatcctcgtcattgtgcttctgctctttggcggtgccaaattgccggcgctggcccgc ggtctgggtcagtcgatcaaggagttcaagaaggcccaggtcatggatgaggacgacgac gatgacgaggacgggaacgaccggaaaaaaaagacgggttcaccgaaactcgcctcgact tcgaaaaaagcgccttccgacaactga

DBGET integrated database retrieval system