Ovis canadensis (bighorn sheep): 138422502 Help Entry 138422502         CDS       T11679                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04060   Cytokine-cytokine receptor interaction ocan04061   Viral protein interaction with cytokine and cytokine receptor ocan04151   PI3K-Akt signaling pathway ocan04625   C-type lectin receptor signaling pathway ocan04630   JAK-STAT signaling pathway ocan04658   Th1 and Th2 cell differentiation ocan04659   Th17 cell differentiation ocan04660   T cell receptor signaling pathway ocan04672   Intestinal immune network for IgA production ocan04940   Type I diabetes mellitus ocan05135   Yersinia infection ocan05142   Chagas disease ocan05162   Measles ocan05166   Human T-cell leukemia virus 1 infection ocan05171   Coronavirus disease ocan05200   Pathways in cancer ocan05320   Autoimmune thyroid disease ocan05321   Inflammatory bowel disease ocan05330   Allograft rejection ocan05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:ocan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     138422502 (IL2)    04151 PI3K-Akt signaling pathway     138422502 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138422502 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     138422502 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     138422502 (IL2)    04660 T cell receptor signaling pathway     138422502 (IL2)    04658 Th1 and Th2 cell differentiation     138422502 (IL2)    04659 Th17 cell differentiation     138422502 (IL2)    04672 Intestinal immune network for IgA production     138422502 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     138422502 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     138422502 (IL2)    05171 Coronavirus disease     138422502 (IL2)    05162 Measles     138422502 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     138422502 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     138422502 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     138422502 (IL2)    05321 Inflammatory bowel disease     138422502 (IL2)    05330 Allograft rejection     138422502 (IL2)    05332 Graft-versus-host disease     138422502 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     138422502 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocan04052]     138422502 (IL2)    00536 Glycosaminoglycan binding proteins [BR:ocan00536]     138422502 (IL2) Cytokines and neuropeptides [BR:ocan04052]  Cytokines   Interleukins    138422502 (IL2) Glycosaminoglycan binding proteins [BR:ocan00536]  Heparan sulfate / Heparin   Cytokines    138422502 (IL2) SSDB OrthologParalogGFIT Motif Pfam:  IL2 DISC1 SYN8_N HEAT_Spiral_Tel1 Motif Other DBs NCBI-GeneID:  138422502 NCBI-ProteinID:  XP_069413598 LinkDB All DBs Position 17:45711557..45716062 Genome browser AA seq 155 aa AA seqDB search MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH TFNFYMPKVNATELKHLKCLLEELKLLEEVLDLAPSKNLNTREIKDSMDNIKRIVLELQG SETRFTCEYDDATVKAVEFLNKWITFCQSIYSTMT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat ttacagttgcttttggagaaagttaaaaatcccgagaacctcaagctctccaggatgcat acatttaacttctacatgcccaaggttaacgctacagaattgaaacatcttaagtgttta ctagaagaactcaaacttctagaggaagtgctagatttagctccaagcaaaaacctgaac accagagagatcaaggattcaatggacaatatcaagagaatagttttggaactacaggga tctgaaacaagattcacatgtgaatatgatgatgcgacagtaaaggctgtagaatttctg aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system