Ovis canadensis (bighorn sheep): 138425643 Help Entry 138425643         CDS       T11679                                  Name (RefSeq) histone H2B type 1-N   KO K11252   histone H2B Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04613   Neutrophil extracellular trap formation ocan05034   Alcoholism ocan05203   Viral carcinogenesis ocan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     138425643  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     138425643   09163 Immune disease    05322 Systemic lupus erythematosus     138425643   09165 Substance dependence    05034 Alcoholism     138425643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocan03036]     138425643   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocan04147]     138425643 Chromosome and associated proteins [BR:ocan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     138425643 Exosome [BR:ocan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138425643 SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  138425643 NCBI-ProteinID:  XP_069419873 LinkDB All DBs Position 20:complement(45285456..45289930) Genome browser AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccatctaagtccgctccggccccgaagaagggttctaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaattcgttcgtgaacgatattttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacatccagggagatccagacggccgtgcgc ctgctgcttcccggagagctggccaagcacgccgtgtctgagggcaccaaggccgttacc aagtacaccagctctaagtga

DBGET integrated database retrieval system