Ovis canadensis (bighorn sheep): 138428850 Help Entry 138428850         CDS       T11679                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04066   HIF-1 signaling pathway ocan04120   Ubiquitin mediated proteolysis ocan05170   Human immunodeficiency virus 1 infection ocan05200   Pathways in cancer ocan05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:ocan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     138428850 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     138428850 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     138428850 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     138428850 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     138428850 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ocan04121]     138428850 (ELOB)    03400 DNA repair and recombination proteins [BR:ocan03400]     138428850 (ELOB) Ubiquitin system [BR:ocan04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      138428850 (ELOB)    Cul5 complex      138428850 (ELOB) DNA repair and recombination proteins [BR:ocan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      138428850 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  138428850 NCBI-ProteinID:  XP_069425885 LinkDB All DBs Position 24:17527627..17536259 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcaccgtgttcgagctgaagcgcatcgtcgagggtatcctcaagcggccgccggat gagcagcggctgtacaaggacgaccagcttctggacgacggcaagacattgggcgagtgt ggcttcaccagccagacagcacggcctcaggcccccgccactgtggggctagccttcagg gcagatgaggcattcgaggccctgcgcatcgagcccttctccagcccacctgagctgccg gacgtgatgaagccacaggactcaggaagcagcgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system