Ovis canadensis (bighorn sheep): 138434517 Help Entry 138434517         CDS       T11679                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04010   MAPK signaling pathway ocan04020   Calcium signaling pathway ocan04022   cGMP-PKG signaling pathway ocan04114   Oocyte meiosis ocan04218   Cellular senescence ocan04310   Wnt signaling pathway ocan04360   Axon guidance ocan04370   VEGF signaling pathway ocan04380   Osteoclast differentiation ocan04625   C-type lectin receptor signaling pathway ocan04650   Natural killer cell mediated cytotoxicity ocan04658   Th1 and Th2 cell differentiation ocan04659   Th17 cell differentiation ocan04660   T cell receptor signaling pathway ocan04662   B cell receptor signaling pathway ocan04720   Long-term potentiation ocan04724   Glutamatergic synapse ocan04921   Oxytocin signaling pathway ocan04922   Glucagon signaling pathway ocan04924   Renin secretion ocan05010   Alzheimer disease ocan05014   Amyotrophic lateral sclerosis ocan05020   Prion disease ocan05022   Pathways of neurodegeneration - multiple diseases ocan05031   Amphetamine addiction ocan05152   Tuberculosis ocan05163   Human cytomegalovirus infection ocan05166   Human T-cell leukemia virus 1 infection ocan05167   Kaposi sarcoma-associated herpesvirus infection ocan05170   Human immunodeficiency virus 1 infection ocan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     138434517 (PPP3R2)    04310 Wnt signaling pathway     138434517 (PPP3R2)    04370 VEGF signaling pathway     138434517 (PPP3R2)    04020 Calcium signaling pathway     138434517 (PPP3R2)    04022 cGMP-PKG signaling pathway     138434517 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     138434517 (PPP3R2)    04218 Cellular senescence     138434517 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     138434517 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     138434517 (PPP3R2)    04660 T cell receptor signaling pathway     138434517 (PPP3R2)    04658 Th1 and Th2 cell differentiation     138434517 (PPP3R2)    04659 Th17 cell differentiation     138434517 (PPP3R2)    04662 B cell receptor signaling pathway     138434517 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     138434517 (PPP3R2)    04921 Oxytocin signaling pathway     138434517 (PPP3R2)    04924 Renin secretion     138434517 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     138434517 (PPP3R2)    04720 Long-term potentiation     138434517 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     138434517 (PPP3R2)    04380 Osteoclast differentiation     138434517 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     138434517 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     138434517 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     138434517 (PPP3R2)    05163 Human cytomegalovirus infection     138434517 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     138434517 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     138434517 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     138434517 (PPP3R2)    05014 Amyotrophic lateral sclerosis     138434517 (PPP3R2)    05020 Prion disease     138434517 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     138434517 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     138434517 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138434517 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ocan01009]     138434517 (PPP3R2) Protein phosphatases and associated proteins [BR:ocan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      138434517 (PPP3R2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF_SSP120 EF-hand_FSTL1 SPARC_Ca_bdg EH EF-hand_9 USP32_N YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  138434517 NCBI-ProteinID:  XP_069435451 LinkDB All DBs Position 2:21617671..21618252 Genome browser AA seq 171 aa AA seqDB search MGNEASYPEEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKELFTSIPELQKNPLVQRVI DVFDTDGDGQVDFQEFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYIANGELFQVLKMM VGDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEVHKHLVTIV NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccggaggagatatgctcgcactttgacgaagatgaaatt aaaaggctgcgcaagcggtttaagaagctggacttggacagttccagcgctctgagcgtc aaagagttgttcacgtccataccggagctgcagaagaacccgctggtgcagcgggtgatc gacgtcttcgacaccgacggcgacggacaggtggacttccaggaattcattttggggacc tcccagttcagcgtccggggagatgaggagcaaaagctgaggtttgctttcagcatctat gacatggacaaagacggctacattgccaacggggagctcttccaggtgctgaagatgatg gtgggggacaatctgaaagactggcagttacagcagctggtggacaaaaccatcatcctc ctggacaaagacggggatgggaaaatctccttccaggaattcagtgctgtggtcagaagc ctggaggtccacaagcacttggtgaccattgtgtga

DBGET integrated database retrieval system