Ovis canadensis (bighorn sheep): 138434597 Help Entry 138434597         CDS       T11679                                  Name (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04060   Cytokine-cytokine receptor interaction ocan04151   PI3K-Akt signaling pathway ocan04217   Necroptosis ocan04620   Toll-like receptor signaling pathway ocan04621   NOD-like receptor signaling pathway ocan04622   RIG-I-like receptor signaling pathway ocan04623   Cytosolic DNA-sensing pathway ocan04630   JAK-STAT signaling pathway ocan04650   Natural killer cell mediated cytotoxicity ocan04936   Alcoholic liver disease ocan05152   Tuberculosis ocan05160   Hepatitis C ocan05161   Hepatitis B ocan05162   Measles ocan05163   Human cytomegalovirus infection ocan05164   Influenza A ocan05165   Human papillomavirus infection ocan05167   Kaposi sarcoma-associated herpesvirus infection ocan05168   Herpes simplex virus 1 infection ocan05169   Epstein-Barr virus infection ocan05170   Human immunodeficiency virus 1 infection ocan05171   Coronavirus disease ocan05200   Pathways in cancer ocan05320   Autoimmune thyroid disease ocan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     138434597    04151 PI3K-Akt signaling pathway     138434597   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138434597  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     138434597  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138434597    04621 NOD-like receptor signaling pathway     138434597    04622 RIG-I-like receptor signaling pathway     138434597    04623 Cytosolic DNA-sensing pathway     138434597    04650 Natural killer cell mediated cytotoxicity     138434597  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     138434597   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     138434597    05161 Hepatitis B     138434597    05160 Hepatitis C     138434597    05171 Coronavirus disease     138434597    05164 Influenza A     138434597    05162 Measles     138434597    05168 Herpes simplex virus 1 infection     138434597    05163 Human cytomegalovirus infection     138434597    05167 Kaposi sarcoma-associated herpesvirus infection     138434597    05169 Epstein-Barr virus infection     138434597    05165 Human papillomavirus infection     138434597   09171 Infectious disease: bacterial    05152 Tuberculosis     138434597   09163 Immune disease    05320 Autoimmune thyroid disease     138434597   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138434597   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     138434597  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocan04052]     138434597 Cytokines and neuropeptides [BR:ocan04052]  Cytokines   Interferons    138434597 SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  138434597 NCBI-ProteinID:  XP_069435510 LinkDB All DBs Position 2:complement(90346156..90346725) Genome browser AA seq 189 aa AA seqDB search MAAAWSLLLALLLLSCNATCSRGCHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRTTLDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcctggtccttactcctggccctgctgctgctcagctgcaacgccacctgc tctcggggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacgctc ctgcggcaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgctgcgtgg gaccagagcctcctggacaagctccgcaccacactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

DBGET integrated database retrieval system