Ovis canadensis (bighorn sheep): 138447117 Help Entry 138447117         CDS       T11679                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04060   Cytokine-cytokine receptor interaction ocan04061   Viral protein interaction with cytokine and cytokine receptor ocan04062   Chemokine signaling pathway ocan04620   Toll-like receptor signaling pathway ocan05142   Chagas disease ocan05163   Human cytomegalovirus infection ocan05323   Rheumatoid arthritis ocan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138447117    04061 Viral protein interaction with cytokine and cytokine receptor     138447117  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138447117    04062 Chemokine signaling pathway     138447117  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     138447117   09174 Infectious disease: parasitic    05142 Chagas disease     138447117   09163 Immune disease    05323 Rheumatoid arthritis     138447117   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138447117  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocan04052]     138447117    00536 Glycosaminoglycan binding proteins [BR:ocan00536]     138447117 Cytokines and neuropeptides [BR:ocan04052]  Cytokines   Chemokines    138447117 Glycosaminoglycan binding proteins [BR:ocan00536]  Heparan sulfate / Heparin   Chemokines    138447117 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  138447117 NCBI-ProteinID:  XP_069458608 LinkDB All DBs Position 11:22751879..22753938 Genome browser AA seq 93 aa AA seqDB search MKAPAAALAVLLCTMALCSQVFSAPFGADTPTACCFSYAARQLSRKIVADYFETSSQCSK PGVIFQTKRGRQVCANPSEDWVQQYITDLELNS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggcacccgcggctgctctcgctgttcttctctgcaccatggccctctgcagccag gtcttctcggcaccatttggcgctgacaccccaacggcctgctgcttctcctatgccgcc cggcagctttctcgcaaaatcgtagccgactattttgagaccagcagccagtgctccaag cctggtgtcatcttccagaccaaaagaggccggcaggtgtgtgccaaccccagtgaggac tgggtccagcaatacatcaccgacctggagctgaattcctga

DBGET integrated database retrieval system