Ochrobactrum sp. BTU1: KMS41_05460
Help
Entry
KMS41_05460 CDS
T09943
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
occ
Ochrobactrum sp. BTU1
Pathway
occ02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
occ00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
KMS41_05460 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
occ02000
]
KMS41_05460 (phnC)
Enzymes [BR:
occ01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
KMS41_05460 (phnC)
Transporters [BR:
occ02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
KMS41_05460 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
AAA_22
SMC_N
SbcC_Walker_B
MMR_HSR1
AAA_16
NB-ARC
RsgA_GTPase
AAA_23
AAA_30
nSTAND1
DO-GTPase2
Adeno_IVa2
RNA_pol_Rpb6
DUF87
Zeta_toxin
AAA_15
Motif
Other DBs
NCBI-ProteinID:
QWK78674
LinkDB
All DBs
Position
1:complement(1130593..1131420)
Genome browser
AA seq
275 aa
AA seq
DB search
MLQLKNVTRRYNDKVAVSGVDLEIEPGSFVGIIGRSGAGKSTLLRMINRLVEPSEGTIHW
DGRDVTGLKGSGLRDWRAQCAMIFQHFNLVDRLDVLTNVLMGRLNYVSTPKSLLRIWSDE
ERLIALSALQQFDIAHLAAHRADELSGGQQQRVAIARALVQQPRIILADEPIASLDPRNT
RSVMDALRRINREYGITVLCNLHSLDIARSYCDRLVGMSAGKIVFRGTPSMLTDMASRDL
YGMEADDVIDTDEQAETMPMPVPQSAEAVLRQLSA
NT seq
828 nt
NT seq
+upstream
nt +downstream
nt
atgcttcaactaaaaaacgtaacgcgccgctataatgataaggtggcggtttcgggtgtt
gacctcgagatcgagcccggctcgtttgttggaattattggtcgctcgggcgcggggaag
tcgacgctgctgcgtatgatcaatcgcctggttgagccttcagagggaacaattcactgg
gatggtcgcgacgttaccgggctcaagggttcgggattgcgcgattggcgcgcacaatgc
gcgatgattttccagcatttcaatctggtcgatcgtcttgatgttctaaccaatgttctg
atggggcgtctcaactatgtttcgacgcctaagtcgctcctgcgtatctggagcgatgaa
gagcgtctgatcgctctttcggcgttgcagcaattcgatattgcgcatcttgcagcccat
cgcgctgatgagctttcgggtggtcagcagcagcgcgtggccattgcccgtgcgcttgtt
cagcagccgcgcatcattctcgcagacgagccgattgcatcgctcgatccgcgcaatacc
cgcagcgtcatggacgctttgcgtcgcatcaatcgcgaatatggcatcacggttctctgc
aatctgcactcgctcgatattgcgcgcagctattgcgatcgcctcgtcggcatgtctgcc
ggcaagatcgtattccgcggcacaccgtcgatgctgaccgatatggcatcacgcgacctt
tacggcatggaagccgatgacgtcatcgataccgatgaacaggctgaaacaatgccaatg
ccagttccgcagtcggccgaagccgttctgcgccagctttccgcctga
DBGET
integrated database retrieval system