Oceanimonas sp. GK1: GU3_04335 Help Entry GU3_04335         CDS       T01667                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism oce  Oceanimonas sp. GK1 Brite KEGG Orthology (KO) [BR:oce00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oce03036]     GU3_04335 Chromosome and associated proteins [BR:oce03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     GU3_04335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC FtsL_2 DUF4446 Motif Other DBs NCBI-ProteinID:  AEY00624 LinkDB All DBs Position 939489..939800 Genome browser AA seq 103 aa AA seqDB search MESRINLAREIGRDLWRYKWLLGLAMITVVSAMTVIVVTHSTRQKTSEYNELMAEQDKLD IEWRNLLLEQNTLMEHSRIEALAREKLGMKRPEPGKEKLVMQP NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggaaagccgcatcaacctggcccgggaaatcgggcgggatctgtggcgttacaaatgg ctgctggggctggccatgatcaccgtggtgtcggccatgacggtgatcgtggtgacccac agtacccgtcaaaaaaccagtgaatacaacgagctgatggccgagcaggacaagctcgac atcgaatggcgcaacctgctgctggagcagaacaccctgatggagcacagccgcatcgag gccctggcccgggaaaaactgggcatgaagcggcccgagccgggcaaggaaaaactggtg atgcaaccatga

DBGET integrated database retrieval system