Okeanomitos corallinicola: WJM97_03660 Help Entry WJM97_03660       CDS       T10416                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ocf  Okeanomitos corallinicola Pathway ocf01100   Metabolic pathways ocf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ocf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WJM97_03660 (acpP)    00074 Mycolic acid biosynthesis     WJM97_03660 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WJM97_03660 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  WZB88790 LinkDB All DBs Position 843403..843636 Genome browser AA seq 77 aa AA seqDB search MSILEKVKEIVSEQLGVEKEKVKPEASFTEDLSADSLDVVELVMALEEEFGIEIPDEDAE KIQKVQDVVDYINKKQG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtattttggaaaaggttaaagaaattgtctccgaacaactaggagtggagaaagaa aaagtcaagcctgaagcctcatttacagaggatttatcagctgactccctcgatgttgtg gaattagtcatggcattggaagaagaatttggtatagaaattcctgatgaagatgctgaa aaaattcagaaggttcaagatgtagtagactacatcaacaaaaagcaaggctaa

DBGET integrated database retrieval system