Okeanomitos corallinicola: WJM97_08380 Help Entry WJM97_08380       CDS       T10416                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ocf  Okeanomitos corallinicola Brite KEGG Orthology (KO) [BR:ocf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ocf03032]     WJM97_08380    03036 Chromosome and associated proteins [BR:ocf03036]     WJM97_08380    03400 DNA repair and recombination proteins [BR:ocf03400]     WJM97_08380 DNA replication proteins [BR:ocf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     WJM97_08380 Chromosome and associated proteins [BR:ocf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     WJM97_08380 DNA repair and recombination proteins [BR:ocf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       WJM97_08380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Transposase_mut HU-CCDC81_euk_2 Pox_C4_C10 Motif Other DBs NCBI-ProteinID:  WZB89693 LinkDB All DBs Position complement(1929009..1929311) Genome browser AA seq 100 aa AA seqDB search MNKGELIDAVAEKATVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREG RNPKTNEKMEIPATKVPAFSAGKLFRERVAPPKEPKEPKE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaacaagggtgaattaattgatgcggtggctgaaaaggctactgtgactaaaaaacaa gcagacgctgttttaactgctgctttagaaaccattatcgaagcggtttcttctggggat aaagttactctcgtagggtttggttcttttgaatcacgggaacggaaagctcgtgaaggt cgcaaccccaaaaccaatgaaaaaatggaaatcccagctaccaaagttcctgccttctct gctgggaaactatttagagaaagggtagcacccccaaaagagccaaaagagccaaaagag tag

DBGET integrated database retrieval system