Afipia carboxidovorans OM5 (Goettingen): OCA5_c25990 Help Entry OCA5_c25990       CDS       T01617                                  Symbol flgJ Name (GenBank) putative flagellar protein FlgJ   KO K02395   peptidoglycan hydrolase FlgJ Organism ocg  Afipia carboxidovorans OM5 (Goettingen) Pathway ocg02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ocg00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     OCA5_c25990 (flgJ)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ocg02035]     OCA5_c25990 (flgJ) Bacterial motility proteins [BR:ocg02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     OCA5_c25990 (flgJ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  AEI07294 UniProt:  B6JBH0 LinkDB All DBs Position 2755088..2755414 Genome browser AA seq 108 aa AA seqDB search MNTSSSMSLINSRPDPVFAQALEKVSPENQAKTKAKAQDFEAVFLNAMFAQMTAGLKSEG PFGDTPSTGVWRSMMTDQYARSFAQAGGIGIGDEVYRTLIMQQANRAA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgaatacctcatcctccatgtcgctgatcaatagccgccccgatccggttttcgcccag gcgctcgaaaaggtttcgccggaaaatcaggccaagaccaaagccaaggcacaggatttc gaggcagtgtttctcaacgcgatgttcgcgcagatgacggcggggctgaagagcgaaggc ccgtttggcgatacgcccagcaccggcgtctggcgttcgatgatgacggaccagtatgcg cgctcgttcgcgcaggccggcggcatcggcatcggcgatgaagtctatcgcacgctgatc atgcagcaggcgaaccgtgcagcctaa

DBGET integrated database retrieval system