Afipia carboxidovorans OM5 (Goettingen): OCA5_c32510 Help Entry OCA5_c32510       CDS       T01617                                  Name (GenBank) ATPase, F0/V0 complex subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ocg  Afipia carboxidovorans OM5 (Goettingen) Pathway ocg00190   Oxidative phosphorylation ocg01100   Metabolic pathways Module ocg_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ocg00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     OCA5_c32510  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ocg00194]     OCA5_c32510 Photosynthesis proteins [BR:ocg00194]  Photosystem and electron transport system   F-type ATPase [OT]    OCA5_c32510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5714 Motif Other DBs NCBI-ProteinID:  AEI07927 UniProt:  B6JDC9 LinkDB All DBs Position 3437633..3437860 Genome browser AA seq 75 aa AA seqDB search MDPIAAKYIGAGLATIGMGGAGVGVGMIFSQFLNGALRNPSASQGQFANLIFGFAVTEAL GIFSLLVALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatcccatcgcagcgaagtacatcggcgcaggtcttgccaccatcggcatgggcggc gccggcgtcggcgtcggcatgatcttcagccagttcctcaacggcgcgctgcgcaatccg tcggcctcgcagggccagttcgcgaacctgattttcggtttcgccgtgaccgaagcgctc ggcatcttctcgctgctcgtcgcgctgctcctgctgttcgctgtctga

DBGET integrated database retrieval system