Ochrobactrum quorumnocens: CES85_0518 Help Entry CES85_0518        CDS       T05040                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism och  Ochrobactrum quorumnocens Pathway och01100   Metabolic pathways och01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:och00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CES85_0518 (acpP)    00074 Mycolic acid biosynthesis     CES85_0518 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CES85_0518 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ASV87216 UniProt:  A0A248UKS2 LinkDB All DBs Position 1:502034..502270 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgagcatctgggtgtagatgca gacaaggtcaccgaaggcgcaagcttcattgatgatcttggtgcagacagcctcgacacc gtcgagctcgtcatggctttcgaagaagaatttggcgttgaaattcctgacgacgctgca gaaacgatcctcacggtcggcgacgctgtgaagttcatcgataaggcttctgcctaa

DBGET integrated database retrieval system