Ochrobactrum quorumnocens: CES85_1246 Help Entry CES85_1246        CDS       T05040                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism och  Ochrobactrum quorumnocens Pathway och02024   Quorum sensing och03018   RNA degradation Brite KEGG Orthology (KO) [BR:och00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CES85_1246 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CES85_1246 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:och03019]     CES85_1246 (hfq)    03036 Chromosome and associated proteins [BR:och03036]     CES85_1246 (hfq) Messenger RNA biogenesis [BR:och03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CES85_1246 (hfq) Chromosome and associated proteins [BR:och03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CES85_1246 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  ASV86545 UniProt:  A0A248UII9 LinkDB All DBs Position 1:complement(1184892..1185128) Genome browser AA seq 78 aa AA seqDB search MAERSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFEGEEV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctgaacgatcgcaaaatcttcaagacctttttctcaactctgtacgcaagcagaaa atttcactgaccatctttcttatcaatggtgtgaaactcacgggtatcgtgacgtctttt gacaatttctgcgtattgctgcgtcgcgatggccattcgcagcttgtttataagcatgca atttcgaccatcatgccaagccagcctgtgcagatgttcgagggcgaggaagtctga

DBGET integrated database retrieval system