Ochrobactrum quorumnocens: CES85_4236 Help Entry CES85_4236        CDS       T05040                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism och  Ochrobactrum quorumnocens Pathway och00190   Oxidative phosphorylation och01100   Metabolic pathways och02020   Two-component system Module och_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:och00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CES85_4236  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CES85_4236 Enzymes [BR:och01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      CES85_4236 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  ASV83456 UniProt:  A0A248U9V8 LinkDB All DBs Position 2:419677..419832 Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAVAFAVLNAMWYELMDDRARKRLAGDPTAELAREGIKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttctcctggcttcttggcctgccgcttgctgtagctttcgccgtattgaac gccatgtggtatgagttgatggacgacagggcgcgtaagcgccttgccggagacccaacc gctgaactggcgcgcgaaggcatcaagcatcattag

DBGET integrated database retrieval system