Oceanihabitans sp. IOP_32: FEZ18_01985 Help Entry FEZ18_01985       CDS       T06249                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism oci  Oceanihabitans sp. IOP_32 Brite KEGG Orthology (KO) [BR:oci00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oci03032]     FEZ18_01985    03036 Chromosome and associated proteins [BR:oci03036]     FEZ18_01985    03400 DNA repair and recombination proteins [BR:oci03400]     FEZ18_01985 DNA replication proteins [BR:oci03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FEZ18_01985 Chromosome and associated proteins [BR:oci03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FEZ18_01985 DNA repair and recombination proteins [BR:oci03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FEZ18_01985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg HU-CCDC81_bac_2 2-Hacid_dh Motif Other DBs NCBI-ProteinID:  QFZ53657 UniProt:  A0A5Q0JS40 LinkDB All DBs Position 488955..489227 Genome browser AA seq 90 aa AA seqDB search MNKTDLIDAMAEHAGITKAAAKKALECALIEIEGALQKGNRVSLVGFGSWSVSKRAAREG RNPQTGETIKIKAKNVVKFKPGSDLTNAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagatttaatcgatgccatggcagagcatgcaggaattacaaaagctgct gcaaaaaaagctttagaatgtgcacttattgaaattgaaggagctttgcaaaaaggcaat agagtttctttagtaggtttcggatcttggtcagtttctaaaagagctgctagagaagga agaaatcctcaaactggtgaaaccattaaaataaaagccaaaaacgttgttaagtttaaa cctggatcagatttaactaatgccgtaaactaa

DBGET integrated database retrieval system