Oceanihabitans sp. IOP_32: FEZ18_06970 Help Entry FEZ18_06970       CDS       T06249                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism oci  Oceanihabitans sp. IOP_32 Pathway oci01100   Metabolic pathways oci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:oci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FEZ18_06970    00074 Mycolic acid biosynthesis     FEZ18_06970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FEZ18_06970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QFZ56017 LinkDB All DBs Position 1678068..1678319 Genome browser AA seq 83 aa AA seqDB search MTKEELISKLKAIIAPYIQDEDAFKNLSEDTDFVKDLKINSANLVDIILDIEDAFDIRLE NEDMEKMLDVKSAMHIVNTKLKA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagaagaactcattagcaaacttaaagccattatcgcgccgtatattcaagat gaagacgcttttaaaaacttatctgaagacaccgattttgttaaagatttaaagataaat tcggcaaatttggtagatattattttagatattgaagatgccttcgacatacggttagaa aacgaggatatggaaaaaatgctcgatgtaaaatcggcaatgcacatcgtgaataccaaa ctaaaagcttaa

DBGET integrated database retrieval system