Oceanisphaera avium: CBP12_03660 Help Entry CBP12_03660       CDS       T04855                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ocm  Oceanisphaera avium Pathway ocm01100   Metabolic pathways ocm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ocm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBP12_03660    00074 Mycolic acid biosynthesis     CBP12_03660   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBP12_03660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 EutQ HLH Motif Other DBs NCBI-ProteinID:  ART79354 UniProt:  A0A1Y0CWH0 LinkDB All DBs Position complement(808476..808712) Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEEVKSEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVKAAVDYINANQE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaaaaaaatcatcattgaacaactgggtgttaaagaa gaagaagttaagtctgaagcttcttttgttgacgacttaggtgccgactctttggacacc gtagagttagtaatggcattggaagaagaattcgacactgaaattcctgatgaagaagct gaaaaaatcactaccgttaaagcggcagttgattacatcaacgcgaatcaagagtaa

DBGET integrated database retrieval system