Afipia carboxidovorans OM4: OCA4_c08910 Help Entry OCA4_c08910       CDS       T01967                                  Name (GenBank) putative tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism oco  Afipia carboxidovorans OM4 Pathway oco00362   Benzoate degradation oco00621   Dioxin degradation oco00622   Xylene degradation oco01100   Metabolic pathways oco01120   Microbial metabolism in diverse environments oco01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:oco00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     OCA4_c08910    00622 Xylene degradation     OCA4_c08910    00621 Dioxin degradation     OCA4_c08910 Enzymes [BR:oco01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      OCA4_c08910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 AMP-binding_C_2 Motif Other DBs NCBI-ProteinID:  AEI02038 LinkDB All DBs Position 952431..952628 Genome browser AA seq 65 aa AA seqDB search MPEITINLAAGRTDEQKRGMMADITAALVKNLGVDPEVVVIQINEAPLSHKMKGGKTYLE RQAKT NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcccgagatcacgatcaacctggcggccggccgcaccgacgagcagaagcgcggcatg atggcggacatcaccgccgcgctcgtcaagaaccttggtgtcgatcccgaggtcgtggtg attcagatcaacgaggcgccactcagccacaagatgaagggcgggaagacctatctggag cgacaggcaaagacataa

DBGET integrated database retrieval system