KEGG   Oryctolagus cuniculus (rabbit): 100008617
Entry
100008617         CDS       T03373                                 

Symbol
CD247
Name
(RefSeq) CD247 molecule
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu05142  Chagas disease
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100008617 (CD247)
   04660 T cell receptor signaling pathway
    100008617 (CD247)
   04658 Th1 and Th2 cell differentiation
    100008617 (CD247)
   04659 Th17 cell differentiation
    100008617 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008617 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100008617 (CD247)
   05169 Epstein-Barr virus infection
    100008617 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100008617 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008617 (CD247)
   04090 CD molecules [BR:ocu04090]
    100008617 (CD247)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100008617 (CD247)
CD molecules [BR:ocu04090]
 Proteins
  100008617 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta
Other DBs
NCBI-GeneID: 100008617
NCBI-ProteinID: NP_001075471
Ensembl: ENSOCUG00000027626
UniProt: Q9TUF8
LinkDB
Position
13
AA seq 165 aa
MKWKVLVIAAVLKAHFPVTEAHIFGLLDPKLCYLLDGILFLYGVIVTALYLRAKFSRGED
VPVSPQGHTQLYNELNIGRREEYDVLDKRRGRDPEMGGKQRRKNPQEGLYNALQKDKMAE
AYSEIGMKGENQRRRGKGHDGLYQGLSAATKDTYDALHMQTLPPR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaagtggaaggttctggtcatcgcggccgtgctgaaggcccatttccccgttacagag
gcacatatctttggcctgctggatcccaaactctgctacctgctggatggaatcctcttc
ctctacggtgtcattgtcaccgccctgtacctgagagcaaagttcagcaggggtgaagac
gtccccgtgtccccgcagggccacacccagctctacaatgagctcaatatcggcagaaga
gaggagtacgacgtgctggacaagaggcggggccgggaccctgagatgggagggaaacag
aggaggaagaaccctcaggaaggcctgtacaacgcactgcagaaagacaagatggcagag
gcctacagtgagattggcatgaaaggcgagaaccagcggcgcagaggcaaggggcatgat
ggcctttaccaggggctcagcgcagccaccaaggacacctacgacgccctccacatgcag
accctgcctcctcgctaa

DBGET integrated database retrieval system