KEGG   Oryctolagus cuniculus (rabbit): 100008628
Entry
100008628         CDS       T03373                                 
Symbol
RYK
Name
(RefSeq) receptor-like tyrosine kinase
  KO
K05128  RYK receptor-like tyrosine kinase [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100008628 (RYK)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100008628 (RYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100008628 (RYK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100008628 (RYK)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  RYK family
   100008628 (RYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase WIF
Other DBs
NCBI-GeneID: 100008628
NCBI-ProteinID: XP_008264428
LinkDB
Position
14:complement(28089071..28149980)
AA seq 475 aa
MDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRK
MCYKKLEEVKTSALDKNASRTIYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHL
HSMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSYPTLRIEKNDLRSVT
LLEAKAKVKDIAISRERITLKDVLQEGTFGRIFHGILLDEKDSNKEKQAFVKTVKDQASE
VQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLKLFLRQCKLVEAN
NPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRDLFP
MDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMA
AYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggacatgccccaggtcaacatttctgttcagggggaagttccacgcactttatcagtg
ttccgggtcgaactttcctgcactggcaaagtagattctgaagttatgatattaatgcaa
ctcaacttgacagtaaattcttcaaaaaattttacagtcttaaattttaaacgaaggaaa
atgtgctacaaaaaacttgaagaagtaaaaacttcagccttggacaaaaatgctagcaga
actatttatgatcctgtacatgcagctccaaccacctctacacgtgtgttttatatcagt
gtaggggtttgttgtgcagtaatatttcttgtagcaataatattagctgttttgcacctt
catagtatgaaaaggattgaactggatgacagtatcagtgccagcagtagctcccaagga
ctgtctcagccatccacccagacgactcagtatctgagagctgacacgcccaacaatgcc
actcctatcaccagttatcctaccttgcggatagagaagaatgacctaagaagtgtcact
cttctggaagccaaagccaaggtgaaggatatagcaatatccagggagaggataactctg
aaagatgtactccaagaaggtacttttgggcgtattttccatgggattttattagatgaa
aaagattcaaataaagaaaaacaagcatttgtaaaaacagttaaagatcaagcttctgaa
gtccaggtgacgatgatgctcactgaaagctgcaagctgcgaggtctccaccacagaaat
cttcttcctattactcatgtgtgtatagaagaaggagaaaagcccatggtgatattgcct
tacatgaattgggggaaccttaaattgtttttaaggcagtgcaaattagtagaggccaat
aatccacaggccatttctcagcaagacctggtgcacatggctattcagattgcctgtgga
atgagctacctggccagaagggaagtcatccataaagacctggctgctaggaactgtgtg
attgatgacacacttcaggtgaagatcactgacaacgccctctccagagacttgttcccc
atggactaccactgtctgggggacaacgaaaacaggccagttcggtggatggctcttgaa
agtctggttaataatgagttctccagtgctagtgacgtgtgggcctttggagtgacgctg
tgggagctcatgactctgggccagacgccctacgtggacatcgacccctttgagatggct
gcgtacctgaaagatggttaccggatagcccagcccatcaactgtcccgatgaactgttt
gctgtgatggcctgttgctgggccttagatccggaggagaggcccaagttccagcagctg
gtgcagtgcctcacagagttccacgcagccttgggagcctacgtgtga

DBGET integrated database retrieval system