KEGG   Oryctolagus cuniculus (rabbit): 100008631
Entry
100008631         CDS       T03373                                 
Symbol
ACVR2A, ACTRIIB
Name
(RefSeq) activin A receptor type 2A
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100008631 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008631 (ACVR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100008631 (ACVR2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100008631 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100008631 (ACVR2A)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100008631 (ACVR2A)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100008631 (ACVR2A)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100008631
NCBI-ProteinID: XP_017198324
Ensembl: ENSOCUG00000016398
LinkDB
Position
7:86489488..86584249
AA seq 513 aa
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgttcgccgtctttcttatctcttgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtcttttctttaacgctaattgggaaagagac
agaactaatcaaactggtgttgaaccctgttatggtgacaaagataaacggcggcattgt
tttgctacttggaagaatatttctggttccatcgaaatagtgaaacaaggttgttggctg
gatgatatcaactgctatgataggactgactgtatagaaaaaaaagacagccctgaagta
tatttttgttgctgcgagggcaacatgtgtaatgaaaagttttcttattttccggagatg
gaagtcactcagcccacttcaaatccagttacacctaaaccaccctattacaatatcctg
ctctattccttggtgccacttatgttaattgcggggattgtcatttgtgcattttgggtg
tacaggcatcacaagatggcctaccctcctgtacttgttccaactcaggacccgggacca
cccccaccttctccattactaggtttgaagccactacagttattagaagtaaaagcaagg
ggaagatttggttgtgtctggaaagcccagttgctcaacgaatatgtagctgtcaaaata
tttccaatacaggacaaacagtcatggcaaaatgagtatgaagtctatagtttgccagga
atgaagcacgagaacatactacagttcattggtgcagaaaaacggggcaccagtgttgat
gtggatctttggctaatcacagcatttcatgaaaagggttcattgtcagactttcttaag
gctaatgtggtctcttggaatgaactgtgtcatattgcagaaacaatggcgagaggacta
gcatatttacatgaggatatacctggcctaaaagatggccacaaacctgccatatctcac
agggacatcaaaagtaaaaatgtgctgttaaaaaacaatctgacagcttgcattgctgat
tttgggttggcgttaaagtttgaagctggcaagtctgcaggtgatacccatggacaggtt
ggtacccggaggtatatggctccagaggtattagagggtgctataaacttccaaagggat
gcatttttgaggatagatatgtacgccatgggattagtcctgtgggaactggcttctcgc
tgtactgctgcagatggacctgtagatgagtatatgttgccatttgaggaggaaattggc
cagcatccatctcttgaagacatgcaggaagttgttgtgcataaaaagaagaggcctgtt
ttaagagattattggcagaaacatgctggaatggcaatgctctgtgaaacgatagaagaa
tgttgggatcacgatgcagaagccaggctatcagctggatgtgtaggtgaaagaattact
cagatgcaaagactaacaaatatcatcaccacagaggacattgtaacagtggtcacgatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

KEGG   Oryctolagus cuniculus (rabbit): 103347244
Entry
103347244         CDS       T03373                                 
Symbol
ACVR2B
Name
(RefSeq) activin A receptor type 2B
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103347244 (ACVR2B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103347244 (ACVR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103347244 (ACVR2B)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103347244 (ACVR2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    103347244 (ACVR2B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103347244 (ACVR2B)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103347244 (ACVR2B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp
Other DBs
NCBI-GeneID: 103347244
NCBI-ProteinID: XP_008251950
LinkDB
Position
Un
AA seq 538 aa
MPFPRSGPGPRRSREPRRLWPWSAQAGDSRAEGQPHSTGSGRGEAETRECIYYNANWELE
RTNQSGLERCEGERDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQV
YFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLLVLLAFWI
YRHRKPPYGHVDVHEDPAPPPPSPLVGLKPLQLLEVKARGRFGCVWKAQLMNDFVAVKIF
PLQDKQSWQSEREIFSTPGMRHENLLQFIAAEKRGSSLEVELWLITAFHDKGSLTDYLKG
NIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTVVLAD
FGLAVRFEPGKPPGDTHGQVRGRGLGEGTGRGPPDEVAEGAITQRELLRIDMYAMGLVLW
ELVSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPAIKDHWLKHPGLAQLC
VTIEECWDHDAEARLSAGCVEERVSLMRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgcccttcccccgcagcgggccaggcccccggcgctcccgggagcccaggcggctgtgg
ccctggagcgcccaggccggggactccagggcagaggggcagcctcactccacaggctct
gggcgcggcgaggccgagacgcgggagtgcatctactacaacgccaactgggagctggag
cgcaccaaccagagcggcctggagcgctgcgagggcgagcgggacaagcggctgcactgc
tacgcctcctggcgcaacagctccggcaccatcgagctcgtcaagaagggctgctggctg
gacgacttcaactgctacgacaggcaggagtgcgtggccaccgaggagaacccccaggtg
tacttctgctgctgcgaaggcaacttctgcaacgagcgcttcacccacctgccagaggcc
ggcggcccggaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctg
gcctactcgctgctgcccatcgggggcctgtccctccttgtcctgctggccttctggata
taccggcatcgcaagcctccctacggccacgtggacgtccatgaggaccccgcgcctccc
ccgccgtcccctctggtggggctgaagccgctgcagctgctggaggtcaaggcccggggg
cgctttggctgtgtctggaaggcccagctcatgaacgacttcgtggccgtcaagatcttc
ccgctccaggacaagcagtcgtggcagagtgagcgggagatcttcagcacgcccggcatg
aggcacgagaacctgctgcagttcatcgctgcggagaagcgaggctccagcctggaggtg
gagctgtggctcatcacggccttccacgacaagggctccctcacggattacctcaagggg
aacatcatcacgtggaatgaactgtgtcacgtggcagagacgatgtcacgaggcctctcg
tacctgcacgaggacgtgccctggtgccgtggtgagggccacaagccgtctattgcccac
agggacttcaagagcaagaatgtactgctgaagagtgacctcacggtcgtgctggccgac
ttcggcctggccgttcggtttgagccgggaaaacccccaggggatacacatgggcaggta
agaggccgcgggctgggggagggaacaggcaggggtccacctgatgaggttgctgaagga
gccatcactcagagagagctcctgcgcatcgacatgtacgccatggggctggtgctgtgg
gagctggtgtcccgctgcaaggctgccgacggacctgtggacgagtacatgctgcccttc
gaggaggagatcggccagcacccctccctggaggagctgcaggaggtggttgtgcacaag
aagatgaggcccgccattaaggatcactggctgaagcacccgggcctggcccagctctgt
gtgaccatcgaggagtgctgggaccacgacgcggaggcgcgcctgtctgcgggctgcgtg
gaggagcgggtgtccctgatgcgcaggtccgtcaacggcactacctcggactgcctcgtc
tccctggtgacctccgtcaccaacgtggacctgcctccgaaagagtcgagcatctga

DBGET integrated database retrieval system