KEGG   Oryctolagus cuniculus (rabbit): 100008677
Entry
100008677         CDS       T03373                                 
Symbol
EEF1A2, EEF1A-2
Name
(RefSeq) eukaryotic translation elongation factor 1 alpha 2
  KO
K03231  elongation factor 1-alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  Nucleocytoplasmic transport
ocu05134  Legionellosis
ocu05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100008677 (EEF1A2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100008677 (EEF1A2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100008677 (EEF1A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100008677 (EEF1A2)
   03016 Transfer RNA biogenesis [BR:ocu03016]
    100008677 (EEF1A2)
   03012 Translation factors [BR:ocu03012]
    100008677 (EEF1A2)
   04131 Membrane trafficking [BR:ocu04131]
    100008677 (EEF1A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008677 (EEF1A2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     100008677 (EEF1A2)
Transfer RNA biogenesis [BR:ocu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    100008677 (EEF1A2)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Elongation factors
   100008677 (EEF1A2)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    100008677 (EEF1A2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100008677 (EEF1A2)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 G-alpha
Other DBs
NCBI-GeneID: 100008677
NCBI-ProteinID: NP_001075500
UniProt: Q71V39
Structure
LinkDB
AA seq 463 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPV
IDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggcaaggagaagacgcacatcaacatcgtggtcatcggccatgtggactcgggcaag
tccaccaccaccggccacctcatctacaagtgcgggggcatcgacaagaggaccatcgag
aagtttgaaaaggaggcggccgagatggggaaaggctccttcaagtacgcctgggtgctg
gacaagctgaaggccgagcgggagcgcggcatcaccatcgacatctccctctggaagttc
gagaccaccaagtactacatcaccatcatcgacgcgcccggccaccgcgacttcatcaag
aacatgatcacgggcacgtcccaggcggactgcgcggtgctcatcgtggccgcgggcgtg
ggcgagtttgaggccggcatctccaagaacgggcagacgcgggagcacgcgctgctggcc
tacacgctgggcgtgaagcagctcatcgtgggcgtcaacaagatggactccacagagccg
gcctacagcgagaagcgctacgacgagatcgtcaaggaggtcagcgcctacatcaagaag
atcggctacaacccggccaccgtgcccttcgtgcccatctcgggctggcacggggacaac
atgctggagccctcccccaacatgccgtggttcaagggctggaaagtggagcggaaggaa
ggcaatgccagcggcgtgtccctgctcgaggcgctggacaccatcctgccccccacgcgc
cccacagacaagccgctgcgcctgcccctgcaggacgtgtacaagattggcggcatcggc
acggtgcccgtgggccgcgtggagaccggcatcctgcggcccggcatggtggtgaccttt
gcccccgtgaacatcaccacggaggtgaagtcggtggagatgcaccatgaggcgctgagc
gaggcgctgcccggggacaacgtgggcttcaacgtcaagaacgtgtccgtgaaggacatc
cggcggggcaacgtgtgtggggacagcaagtccgacccgccgcaggaggccgcgcagttc
acctcccaggtcatcatcctgaaccaccccggccagatcagcgccggctactcgccggtc
atcgactgccacacggcccacatcgcctgcaagttcgccgagctcaaggagaagatcgac
cggcgctcgggcaagaagctggaggacaaccccaagtccctcaagtccggggacgcggcc
atcgtggagatggtgcccgggaagcccatgtgtgtggagagcttctcccagtacccgccc
ctcggccgcttcgccgtgcgcgacatgcggcagacggtggccgtgggcgtcatcaagaac
gtggagaagaagagcggcggcgccggcaaggtcaccaagtcggcgcagaaggcgcagaag
gccggcaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100009189
Entry
100009189         CDS       T03373                                 
Symbol
EEF1A1, RABEFLA2
Name
(RefSeq) eukaryotic translation elongation factor 1 alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  Nucleocytoplasmic transport
ocu05134  Legionellosis
ocu05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100009189 (EEF1A1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100009189 (EEF1A1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100009189 (EEF1A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009189 (EEF1A1)
   03016 Transfer RNA biogenesis [BR:ocu03016]
    100009189 (EEF1A1)
   03012 Translation factors [BR:ocu03012]
    100009189 (EEF1A1)
   04131 Membrane trafficking [BR:ocu04131]
    100009189 (EEF1A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009189 (EEF1A1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     100009189 (EEF1A1)
Transfer RNA biogenesis [BR:ocu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    100009189 (EEF1A1)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Elongation factors
   100009189 (EEF1A1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    100009189 (EEF1A1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100009189 (EEF1A1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 100009189
NCBI-ProteinID: NP_001075808
Ensembl: ENSOCUG00000008481
UniProt: P68105 B7NZC3
Structure
LinkDB
Position
12:complement(60379747..60382266)
AA seq 462 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggaaaagactcacatcaacatcgtcgtcattggccacgtagattcgggcaag
tccaccaccactggccatctgatctacaaatgtggtggcatcgacaaaagaaccattgaa
aaatttgagaaggaggctgccgagatgggaaagggctccttcaagtatgcctgggtcttg
gataaactgaaagccgagcgtgagcgtggtatcaccatcgacatctccctgtggaaattt
gagaccagcaagtattacgtgactatcattgatgccccaggacacagagacttcatcaaa
aacatgattacaggcacatctcaggctgactgtgccgtcctgattgttgctgctggtgtc
ggggaatttgaagctggtatctccaagaacgggcagacccgtgagcatgcccttctggct
tacacgctgggtgtgaaacagctaattgttggtgttaacaagatggattccactgagcca
ccctacagccagaagagatacgaggaaatcgttaaggaagtcagcacctacattaagaaa
attggctacaaccctgacacagtagcatttgtgccaatttctggttggaacggtgacaac
atgctggagccaagtgctaatatgccgtggttcaagggatggaaagtcacccgcaaagat
ggcaatgccagtggaaccacactgcttgaagccctggactgcatccttccaccaactaga
ccaactgacaagcctctgcgtctgcccctacaggatgtctacaaaattggtggtattggc
actgtccctgtgggccgagtggagactggtgttctcaaacctggcatggtggtaactttt
gctccagtcaatgtcacaactgaagtcaagtccgtcgaaatgcaccatgaagctttgagt
gaagctcttcctggggacaatgtgggcttcaatgtcaagaacgtgtctgtcaaagatgtt
cgtcgtggcaacgttgctggtgacagcaaaaatgacccaccaatggaagcagctggcttc
actgctcaggtgatcatcctgaaccatccaggtcagatcagtgctgggtatgcccctgta
ctggattgtcacacagctcacattgcttgcaagtttgctgagctgaaggaaaagattgat
cgtcgttctggaaagaagttggaagatggccctaaattcttgaaatctggtgatgctgcc
attgttgatatggttcccggcaagcccatgtgtgttgagagcttctctgactatcctcct
ctgggtcgtttcgctgtccgtgatatgagacagacggttgctgtgggtgtgatcaaagca
gtggacaagaaggctgctggagctggcaaggtcaccaagtctgcccagaaagctcagaag
gctaaatga

DBGET integrated database retrieval system