Oryctolagus cuniculus (rabbit): 100008682 Help Entry 100008682         CDS       T03373                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04144   Endocytosis ocu04145   Phagosome ocu04148   Efferocytosis ocu05132   Salmonella infection ocu05146   Amoebiasis ocu05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ocu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100008682 (RAB7A)    04145 Phagosome     100008682 (RAB7A)    04140 Autophagy - animal     100008682 (RAB7A)    04137 Mitophagy - animal     100008682 (RAB7A)    04148 Efferocytosis     100008682 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100008682 (RAB7A)    05152 Tuberculosis     100008682 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100008682 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100008682 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100008682 (RAB7A)    04031 GTP-binding proteins [BR:ocu04031]     100008682 (RAB7A) Membrane trafficking [BR:ocu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     100008682 (RAB7A) Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100008682 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    100008682 (RAB7A)   Exosomal proteins of colorectal cancer cells    100008682 (RAB7A)   Exosomal proteins of bladder cancer cells    100008682 (RAB7A) GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     100008682 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_22 NTPase_1 AAA_7 AAA_24 AAA_16 AAA_5 G-alpha SRPRB ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  100008682 NCBI-ProteinID:  NP_001075503 Ensembl:  ENSOCUG00000001645 UniProt:  O97572 LinkDB All DBs Position 9:complement(108402880..108475592) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLSVAFYRGADCCVLVFDVTAPNTFKTLDSWRLEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWSYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPMKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggtgatcatcttgggagattctggagttggt aagacatcactcatgaaccagtacgtgaacaagaaattcagtaaccagtacaaagccaca ataggagcagactttctgaccaaggaggtgatggtggatgacaggctagttacgatgcag atctgggacacagcaggacaggaacggttccagtctctcagtgtggccttctacagaggt gcagactgctgcgttctggtattcgacgtgaccgcccccaacaccttcaaaacgcttgat agctggagacttgagtttctcatccaggccagtccccgggatccggaaaacttccccttt gttgtgttgggaaataagatcgacctcgaaaacagacaagtggccacaaagagggcacag gcctggagctacagcaaaaacaacattccctacttcgaaaccagtgccaaggaggccatc aacgtggagcaggccttccagacgattgcacggaatgcacttaaacaggaaacggaggtg gaactgtacaatgaatttccggaacccatgaaactggacaagaacgaccgggccaagacc tccgcagaaagctgcagctgctga

DBGET integrated database retrieval system