KEGG   Oryctolagus cuniculus (rabbit): 100008747
Entry
100008747         CDS       T03373                                 
Symbol
LEP, OB
Name
(RefSeq) leptin
  KO
K05424  leptin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04080  Neuroactive ligand-receptor interaction
ocu04152  AMPK signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100008747 (LEP)
   04152 AMPK signaling pathway
    100008747 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100008747 (LEP)
   04060 Cytokine-cytokine receptor interaction
    100008747 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100008747 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100008747 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008747 (LEP)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100008747 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 100008747
NCBI-ProteinID: NP_001156541
Ensembl: ENSOCUG00000010189
UniProt: B0KZL0
LinkDB
Position
7:complement(16077858..16090731)
AA seq 167 aa
MRCGPLCQLLWLWPCLSCVPAVPMRKVQDDTKTLIKTIVTRISDISHTQSVSSRQRVVGL
DFIPGLHPNLSLSTMDQTLAIYQQILASLPSRNVIQIANDLENLRDLLHLLASSKSCPLP
RASGLETLEGLGGVLEASLYSTEVVALSRLQGFLQAMLQQLDLGPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcggtgtggacccctctgccaactcctgtggctgtggccctgtctgtcctgtgttcca
gctgtgcccatgcggaaagtccaggatgacaccaagaccctcatcaaaaccattgtcacc
aggatcagtgacatctcacacacgcagtcggtctcctccagacagagggtcgtcggtttg
gacttcatccctggcctccaccccaacctgagcttgtccacaatggaccagacgttggcc
atctaccaacagatcctcgccagtctgccgtcccgaaatgtgatccaaatagccaacgac
ctggagaacctccgggaccttctgcacctgctggcctcgtccaaaagctgccccctgccc
cgagccagtggcttggagaccctggagggcctgggaggcgtcctggaggcgtcactctac
tccacggaggtggtggccctgagcaggctgcaggggttcctgcaggcaatgctgcagcag
ctggacctgggccctgggtgctga

DBGET integrated database retrieval system