KEGG   Oryctolagus cuniculus (rabbit): 100008800
Entry
100008800         CDS       T03373                                 
Symbol
CYBA
Name
(RefSeq) p22-phox
  KO
K08009  cytochrome b-245, alpha polypeptide
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04613  Neutrophil extracellular trap formation
ocu04621  NOD-like receptor signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu05020  Prion disease
ocu05140  Leishmaniasis
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100008800 (CYBA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100008800 (CYBA)
   04621 NOD-like receptor signaling pathway
    100008800 (CYBA)
   04670 Leukocyte transendothelial migration
    100008800 (CYBA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008800 (CYBA)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    100008800 (CYBA)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100008800 (CYBA)
  09164 Neurodegenerative disease
   05020 Prion disease
    100008800 (CYBA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008800 (CYBA)
   05418 Fluid shear stress and atherosclerosis
    100008800 (CYBA)
   05415 Diabetic cardiomyopathy
    100008800 (CYBA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008800 (CYBA)
Membrane trafficking [BR:ocu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100008800 (CYBA)
SSDB
Motif
Pfam: Cytochrom_B558a Cg6151-P
Other DBs
NCBI-GeneID: 100008800
NCBI-ProteinID: NP_001075568
UniProt: Q95MN4
LinkDB
AA seq 194 aa
MGQIEWAMWANEQALASGLILVAGGIVATAGRFTQWYFGTYAIAAGVLVCLLEYPRGSRA
KGSTLERCGQRYLTAVLKLLGPLSRNYYFRAALHLALSVPAGFLLATILGTVCLVIASII
YLLAAVRGEQWTPIEPRPKERPQVGGTIKQPPSNPPPRPPVEARKKPGEEDATPAGGPPG
GPRVNPIPVTDEVV
NT seq 585 nt   +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggctaacgagcaggcgctggcgtccggcctgatc
ctcgtcgcgggaggcatcgtggccacggccgggcgcttcacccagtggtacttcggcacc
tacgccatcgcggcgggggtgctggtctgcctgctggagtacccgcggggcagcagggcc
aagggctccaccctggagcgatgtggacagcgctacctgaccgccgtgctgaagctcctg
gggccgctcagcaggaactactacttccgcgccgcgctgcacctggcgttgtcggtgcct
gcaggcttcctccttgctaccatcctggggaccgtctgcctggtcattgcaagcatcatc
tacctgctggctgccgtccgaggcgagcagtggacgcccatcgagccccggcccaaggag
cggccgcaggtcggaggtaccattaagcaaccgcccagcaacccaccgccccggcccccc
gtggaggcccgcaagaagccgggggaggaggacgcgaccccggccgggggtcccccagga
ggccctcgggtcaaccccatccccgtgacggacgaggtcgtgtga

DBGET integrated database retrieval system