KEGG   Oryctolagus cuniculus (rabbit): 100008801
Entry
100008801         CDS       T03373                                 
Symbol
CYBB, NOX2
Name
(RefSeq) cytochrome b-245 beta polypeptide
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04066  HIF-1 signaling pathway
ocu04145  Phagosome
ocu04216  Ferroptosis
ocu04217  Necroptosis
ocu04613  Neutrophil extracellular trap formation
ocu04621  NOD-like receptor signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05010  Alzheimer disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05140  Leishmaniasis
ocu05171  Coronavirus disease - COVID-19
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100008801 (CYBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100008801 (CYBB)
  09143 Cell growth and death
   04216 Ferroptosis
    100008801 (CYBB)
   04217 Necroptosis
    100008801 (CYBB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100008801 (CYBB)
   04621 NOD-like receptor signaling pathway
    100008801 (CYBB)
   04670 Leukocyte transendothelial migration
    100008801 (CYBB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100008801 (CYBB)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100008801 (CYBB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008801 (CYBB)
   05020 Prion disease
    100008801 (CYBB)
   05022 Pathways of neurodegeneration - multiple diseases
    100008801 (CYBB)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008801 (CYBB)
   05415 Diabetic cardiomyopathy
    100008801 (CYBB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008801 (CYBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008801 (CYBB)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.-  
   1.-.-
    1.-.-.-
     100008801 (CYBB)
Membrane trafficking [BR:ocu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    100008801 (CYBB)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Other DBs
NCBI-GeneID: 100008801
NCBI-ProteinID: NP_001075569
UniProt: Q95MN3
LinkDB
Position
X:23358936..23394566
AA seq 570 aa
MGNWVENEGLSIFVIFVWLGLNVFLFVWYYWVYAFGKKYYYTTKLLGAALPLARAPAACL
NFNCLLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDSYSIALSEIGDKKNETYLNFVRERIKNPEGGLLVAVTRLAGVTGI
IITLCLILIITSSTKIIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTEESLKKHD
PVMCEQHISDWGKIKDCPVPEFSGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPTVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCDNATNLRLKKIYFYWLCRDTHAFEWFADLLQLLETQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggggaactgggttgagaatgaaggactctccatcttcgttattttcgtttggctgggg
ctgaacgtcttcctctttgtgtggtactactgggtttatgcttttggaaagaagtattat
tatactacaaaacttcttggggcagcactgccattggccagggccccagcagcctgcctg
aacttcaactgcctgctgatcctgcttccagtctgtcgaaatctgctctcttttctcagg
ggttccagtgcgtgctgctcaacaagaattcgaagacaactggacagaaatctcactttt
cataaaatggtggcgtggatgattgcacttcattctgcgattcacacaattgcacatcta
ttcaatgtggagtggtgtgtgaatgcccgagtcaacaattctgatagttactcgatagca
ctctctgaaattggggacaaaaagaatgaaacttacctcaattttgttcgagagagaatc
aagaaccctgaaggaggcctgttagtggctgtaacgcggttggcaggcgtcactggaatt
atcatcacactgtgcctcatacttatcatcacatcctccaccaaaatcatccggaggtct
tactttgaagtgttttggtacacacaccatctcttcgtcatattcttcattggtcttgcc
atccatggagctgaacgaattgtacgtgggcaaactgaggagagtctgaagaaacatgat
ccagtgatgtgtgagcaacatatctcagattggggaaagataaaggactgccctgtccca
gaattctctggaaaccctcctatgacctggaaatggatagtgggtcccatgttcctatat
ctctgtgagaggttggtccggttttggcgatctcagcagaaggtggtcatcaccaaggtg
gtcactcaccctttcaaaaccattgaactacaaatgaagaagaaaggattcaagatggag
gtgggacaatatatttttgtcaagtgccccacggtgtccaagctggaatggcaccctttc
acactgacctctgcccctgaagaagacttctttagcatccatatccgcatcgtgggggac
tggacagaggggctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcatgg
aaactacctaagatagcagttgatgggccctttggcacagcaagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagcaggaattggggtcacgccctttgcatccatcctc
aagtcagtctggtacaaatattgtgacaatgccacgaatctgaggctcaaaaagatctac
ttctactggctgtgccgtgacacacatgcctttgagtggtttgcagacttgctgcagctg
ctggagacacagatgcaggagaggaacaatgctggcttcctcagctacaacatctatctc
accggctgggatgagtcccaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggtctgaaacaaaagacactgtatggacgacccaactgggataatgagttc
aagacaattgcaagtcaacaccctaataccagaataggagttttcctctgtggacctgaa
gccttggctgaaaccctcagtaaacagagcatctccaactctgagtctggccctcgggga
gtgcacttcattttcaacaaggaaaacttctga

DBGET integrated database retrieval system