KEGG   Oryctolagus cuniculus (rabbit): 100008802
Entry
100008802         CDS       T03373                                 
Symbol
NCF2
Name
(RefSeq) neutrophil cytosolic factor 2
  KO
K08010  neutrophil cytosolic factor 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04613  Neutrophil extracellular trap formation
ocu04670  Leukocyte transendothelial migration
ocu05020  Prion disease
ocu05140  Leishmaniasis
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100008802 (NCF2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100008802 (NCF2)
   04670 Leukocyte transendothelial migration
    100008802 (NCF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008802 (NCF2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    100008802 (NCF2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100008802 (NCF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100008802 (NCF2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008802 (NCF2)
   05418 Fluid shear stress and atherosclerosis
    100008802 (NCF2)
   05415 Diabetic cardiomyopathy
    100008802 (NCF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008802 (NCF2)
Membrane trafficking [BR:ocu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100008802 (NCF2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 TPR_1 TPR_2 TPR_8 TPR_12 TPR_16 PB1 TPR_9 Cohesin_load ANAPC5
Other DBs
NCBI-GeneID: 100008802
NCBI-ProteinID: NP_001075570
Ensembl: ENSOCUG00000002009
UniProt: Q95MN2
LinkDB
Position
Un
AA seq 543 aa
MSLAEAISLWNEGVLAADREDWRGALAALCAVQDPHARICFNVGCVHAILGDLPEAEKAF
TKSISKDRHLAVAYFQRGMLHHRTERYDSAIKDLKEALTQLRGNQLIDYKILGLQFKLFA
CEVLYNIALMYAKKKEWKKAEEQLALALSMKSEPRHSKVDKAMECVWKQELYEPVVIPVG
RLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFQAL
EGEAHRVLFGFVPETPEELQVMPGNIVFVLKKGSDNWATVMFNGQKGLVPCNYLEPVELR
IHPQQQPQEDTSLEPRVPAPPSASAPRRPQPSAGQRQKEEPQEATRGVPVPYTLKVHYKF
TVLLDTQPQLPYSQLRDAVARKLELAPEHTKLSYRPRAGPELAPLSEASMADAWSHVDGS
CLTLWCENSVGDQGFPEEPDESELSKADDRTTGPKIREGSHVVARFRYEASQPEDLELRE
GDVVLVLSEVNEEWLEGECRGQAGIFPRAFVEEHAPAQLQGTPSAGAGQGALSASETPPS
SLM
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgtccctggcggaggccatcagcctctggaatgagggggtgctggcggctgaccgggag
gactggaggggggccctggccgccctctgcgcagtccaggacccgcacgcccggatctgc
ttcaacgtgggctgcgtgcacgccatcctgggagacctgcctgaggcagagaaggccttt
accaagagcatcagcaaggacaggcacctggccgtggcctacttccagcgggggatgctg
caccaccgcacggagagatacgactctgcgattaaggacctgaaggaggccttgactcag
ctgcgggggaaccagctgattgactacaagatcctgggcctgcagttcaagctgtttgcc
tgcgaggtgttatataacatcgctttgatgtacgccaagaagaaggaatggaaaaaggcg
gaagagcagctggcgctggccctgagcatgaagtccgagccccgccactccaaagtggac
aaggccatggagtgtgtctggaagcaggagctgtatgagcccgtggtgatccccgtgggc
aggctgttccggccgaatgagcggcaggtggcgcagttggccaagaaggactacctgggc
aaggcgacggtcgtggcgtccgtggtggaccaagacagcttctcggggttcgctcctctg
cagcctcaggcagctgagcctccgcccagacccaaaaccccggagatcttccaggcgctg
gaaggggaggcccaccgtgtgctgttcggctttgtgccggagacgccggaggagctccag
gtcatgccgggaaacatcgtctttgtcttgaagaagggcagcgacaactgggccacggtc
atgttcaacggccagaaggggctcgttccctgcaactacctcgaacccgtggagctgcgg
atccaccctcagcagcagccccaggaggacacctccctggagccccgtgtcccagcgcct
cccagtgccagcgcccccaggagaccccagccgtcagcaggtcagagacaaaaggaagag
ccccaggaagccacgcgtggcgtccccgtgccctacacgctcaaggtgcactacaagttc
acggtgctcctggacactcagccccagctcccctacagccagctccgggacgccgtggcc
aggaaactggagctggcgccggaacacacgaagctgagctaccggcctcgggccggcccc
gagctggcgcccctgtcggaggccagcatggcagacgcctggagccacgtggacggcagc
tgcctgaccctgtggtgtgagaactcagtgggtgaccaaggctttccagaggagcccgac
gagagcgagctctccaaggctgacgaccggaccacggggccgaagatccgggaaggcagc
cacgtggtggctcgcttccgttacgaggccagccagccggaggacctggagctgcgggaa
ggggacgtcgtcctggtgctgtcagaggtgaacgaagaatggctggaaggcgagtgcagg
gggcaggcgggcatcttccccagagccttcgtggaagaacacgcacccgcacagctgcag
ggcacgcccagcgccggcgcaggccagggagccctgtcggcctccgagacaccgccctcc
tccctgatgtga

DBGET integrated database retrieval system