KEGG   Oryctolagus cuniculus (rabbit): 100008803
Entry
100008803         CDS       T03373                                 
Symbol
NCF1
Name
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04613  Neutrophil extracellular trap formation
ocu04666  Fc gamma R-mediated phagocytosis
ocu04670  Leukocyte transendothelial migration
ocu05020  Prion disease
ocu05140  Leishmaniasis
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100008803 (NCF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100008803 (NCF1)
   04666 Fc gamma R-mediated phagocytosis
    100008803 (NCF1)
   04670 Leukocyte transendothelial migration
    100008803 (NCF1)
   04062 Chemokine signaling pathway
    100008803 (NCF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008803 (NCF1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    100008803 (NCF1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100008803 (NCF1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100008803 (NCF1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008803 (NCF1)
   05418 Fluid shear stress and atherosclerosis
    100008803 (NCF1)
   05415 Diabetic cardiomyopathy
    100008803 (NCF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008803 (NCF1)
Membrane trafficking [BR:ocu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100008803 (NCF1)
SSDB
Motif
Pfam: SH3_1 NECFESHC SH3_9 p47_phox_C PX SH3_2 hSH3
Other DBs
NCBI-GeneID: 100008803
NCBI-ProteinID: NP_001075571
UniProt: Q95MN0
LinkDB
Position
Un
AA seq 391 aa
MGDAFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVIYRRFTEIYEFHKMLKEMFPI
EAGEINPESRIIPHLPAPRWFDGQRAAESRQGTLTEYCGALMALPVKISRCPHLLNFFKV
RPDDLKLPADSQAKKPETYLMSKDAKSNVADITGPIILQTYRAIANYEKHSPSEMAMATG
DVVDVVEKNESGWWFCQMKTKRGWVPASFLEPLDSPDEPEDPEPNYAGEPYVTIKAYTAV
EEDEVSLAQGEAIEVIHKLLDGWWVVRKEDVTGYFPSMFLQKSGQDLTQAQRQIKSRGAP
PRRSSIRNAHSIHQRARKRLSQDTYRRNSVRYLQQRRRLLPPSQRGAQSPLQEEPRPQST
KPQPAVPPRPSADLILNRCSESTKRKLASTL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgggggacgccttcatccgccacattgccctgctgggctttgagaaacgctttgtcccc
agccagcactacgtgtacatgttcttggtgaagtggcaggacctgtccgagaaggtgatc
taccgccggttcaccgagatctacgagttccacaaaatgttgaaagagatgttccccatc
gaagcaggggaaattaacccggagagccgcatcatcccccacctcccagcccccaggtgg
ttcgacgggcagcgggcggccgagagccgccagggcacgctcaccgagtactgcggcgcg
ctcatggcgctgcccgtcaagatctcccgctgtccacacctgctgaacttcttcaaggtg
cgtccggacgacctcaagctgcccgcggacagccaggcaaaaaagccggagacgtacttg
atgtccaaagacgccaagagcaacgtggcagacatcacgggccccatcattctgcagacc
tatcgcgccatcgccaactacgagaagcactcgccctcggagatggccatggccacgggg
gacgtggtggacgtcgtggagaagaacgagagtggttggtggttctgtcaaatgaagacc
aagcgtggctgggtccccgcgtccttcctggagcccctggacagtcctgacgagccagag
gacccagagcccaactacgcaggtgagccctacgtcaccatcaaagcctacaccgccgtg
gaggaggacgaggtgtccctggcccagggtgaagccatagaggtcattcacaaactcctg
gacggctggtgggtggtcaggaaggaggacgtcactggctacttcccgtccatgttcctg
caaaagtcggggcaggacctgacccaggcccagcgccagatcaagagccggggggcgccg
ccccgcaggtcgtccatccgcaacgcgcacagcatccaccagcgcgcgcgcaagcgcctc
agccaggacacctaccgccgcaacagcgtgcgctacctgcagcagcgccgccgcctgctg
ccgcccagccagcgcggcgcccagagcccgctgcaggaggagccgcggccgcagagcacg
aagccgcagcccgcggtgcccccgcggcccagcgccgatctcatcctgaaccggtgcagc
gagagcaccaagcggaagctggcgtcgaccctgtga

DBGET integrated database retrieval system