Oryctolagus cuniculus (rabbit): 100008823 Help Entry 100008823         CDS       T03373                                  Symbol DBI Name (RefSeq) acyl-CoA-binding protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     100008823 (DBI)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100008823 (DBI) Cytokines and neuropeptides [BR:ocu04052]  Neuropeptides   Unclassified    100008823 (DBI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACBP Motif Other DBs NCBI-GeneID:  100008823 NCBI-ProteinID:  NP_001075582 Ensembl:  ENSOCUG00000004566 UniProt:  Q8WN94 LinkDB All DBs Position 7:109937933..109943165 Genome browser AA seq 87 aa AA seqDB search MSQAEFEKAAEEVKNLKTKPADAEMLFIYSHYKQATVGDVNTERPGMLDLKGKAKWDAWN ELKGTSKESAMRAYVDKVEELKQKYGI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggctgagtttgagaaagctgcagaggaagttaagaacctcaagaccaagcca gcagacgcagagatgctgtttatctacagccattacaaacaggcaaccgtgggtgacgtc aacacagagcggcctgggatgttggacctcaaaggcaaggccaagtgggatgcctggaac gagctgaaagggacttccaaggagagcgccatgagagcgtacgtggacaaagtggaggag ctcaagcagaagtacggaatctaa

DBGET integrated database retrieval system