KEGG   Oryctolagus cuniculus (rabbit): 100008856
Entry
100008856         CDS       T03373                                 
Symbol
JUN, AP-1, C-JUN
Name
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04024  cAMP signaling pathway
ocu04137  Mitophagy - animal
ocu04210  Apoptosis
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05224  Breast cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008856 (JUN)
   04012 ErbB signaling pathway
    100008856 (JUN)
   04310 Wnt signaling pathway
    100008856 (JUN)
   04668 TNF signaling pathway
    100008856 (JUN)
   04024 cAMP signaling pathway
    100008856 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100008856 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100008856 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008856 (JUN)
   04530 Tight junction
    100008856 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100008856 (JUN)
   04621 NOD-like receptor signaling pathway
    100008856 (JUN)
   04625 C-type lectin receptor signaling pathway
    100008856 (JUN)
   04660 T cell receptor signaling pathway
    100008856 (JUN)
   04658 Th1 and Th2 cell differentiation
    100008856 (JUN)
   04659 Th17 cell differentiation
    100008856 (JUN)
   04657 IL-17 signaling pathway
    100008856 (JUN)
   04662 B cell receptor signaling pathway
    100008856 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100008856 (JUN)
   04915 Estrogen signaling pathway
    100008856 (JUN)
   04921 Oxytocin signaling pathway
    100008856 (JUN)
   04926 Relaxin signaling pathway
    100008856 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100008856 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008856 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008856 (JUN)
   05207 Chemical carcinogenesis - receptor activation
    100008856 (JUN)
   05208 Chemical carcinogenesis - reactive oxygen species
    100008856 (JUN)
   05203 Viral carcinogenesis
    100008856 (JUN)
   05231 Choline metabolism in cancer
    100008856 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008856 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100008856 (JUN)
   05211 Renal cell carcinoma
    100008856 (JUN)
   05224 Breast cancer
    100008856 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008856 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100008856 (JUN)
   05161 Hepatitis B
    100008856 (JUN)
   05171 Coronavirus disease - COVID-19
    100008856 (JUN)
   05162 Measles
    100008856 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008856 (JUN)
   05169 Epstein-Barr virus infection
    100008856 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008856 (JUN)
   05135 Yersinia infection
    100008856 (JUN)
   05133 Pertussis
    100008856 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100008856 (JUN)
   05142 Chagas disease
    100008856 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100008856 (JUN)
   05321 Inflammatory bowel disease
    100008856 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100008856 (JUN)
   05031 Amphetamine addiction
    100008856 (JUN)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008856 (JUN)
   05418 Fluid shear stress and atherosclerosis
    100008856 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100008856 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008856 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100008856 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100008856 (JUN)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100008856 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha TFIIA DUF3450
Other DBs
NCBI-GeneID: 100008856
NCBI-ProteinID: NP_001185876
LinkDB
Position
13:107997083..107998198
AA seq 337 aa
MSAKMETTFYDDALNASFLQTESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGGGGSGGFSAGLHSEPPVYANLSNFNPS
ALSSGGGAPSYGAAGLAFPAQPQQQQPPPPPQPPHHLPQQIPVQHPRLQALKEEPQTVPE
MPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSEL
ASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagtgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag
accgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctcatc
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctagccgag
ctgcacagccagaacacgctgcccagcgtcacgtccgcggcgcagccggtcagcggggcg
ggcatggtggctccggccgtggcctcggtggcgggcggcggcggcggcagcggcggcttc
agcgccggcctgcacagcgagccgcctgtctacgccaacctcagcaacttcaacccgagc
gcgctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcg
cagccccagcagcaacagccgccgccgccgccgcagccgccgcaccacctgccccagcag
atccccgtgcagcacccgcggctgcaggcgctcaaggaggagccgcagaccgtgcccgag
atgcccggcgagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaag
gcggagaggaagcgcatgaggaaccgcatcgccgcctccaagtgccggaaaaggaagctg
gagaggatcgctcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctg
gcgtccacggccaacatgctcagggaacaggtggcacagctgaaacagaaagtcatgaac
cacgttaacagcgggtgccaactcatgctaacgcagcagttgcaaacgttctga

KEGG   Oryctolagus cuniculus (rabbit): 100337999
Entry
100337999         CDS       T03373                                 
Symbol
MAPK10
Name
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04926  Relaxin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04936  Alcoholic liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100337999 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100337999 (MAPK10)
   04012 ErbB signaling pathway
    100337999 (MAPK10)
   04014 Ras signaling pathway
    100337999 (MAPK10)
   04310 Wnt signaling pathway
    100337999 (MAPK10)
   04668 TNF signaling pathway
    100337999 (MAPK10)
   04068 FoxO signaling pathway
    100337999 (MAPK10)
   04071 Sphingolipid signaling pathway
    100337999 (MAPK10)
   04024 cAMP signaling pathway
    100337999 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100337999 (MAPK10)
   04137 Mitophagy - animal
    100337999 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100337999 (MAPK10)
   04215 Apoptosis - multiple species
    100337999 (MAPK10)
   04217 Necroptosis
    100337999 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100337999 (MAPK10)
   04530 Tight junction
    100337999 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100337999 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100337999 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100337999 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100337999 (MAPK10)
   04660 T cell receptor signaling pathway
    100337999 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100337999 (MAPK10)
   04659 Th17 cell differentiation
    100337999 (MAPK10)
   04657 IL-17 signaling pathway
    100337999 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100337999 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100337999 (MAPK10)
   04920 Adipocytokine signaling pathway
    100337999 (MAPK10)
   04912 GnRH signaling pathway
    100337999 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100337999 (MAPK10)
   04917 Prolactin signaling pathway
    100337999 (MAPK10)
   04926 Relaxin signaling pathway
    100337999 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    100337999 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100337999 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100337999 (MAPK10)
   04722 Neurotrophin signaling pathway
    100337999 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100337999 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100337999 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337999 (MAPK10)
   05208 Chemical carcinogenesis - reactive oxygen species
    100337999 (MAPK10)
   05231 Choline metabolism in cancer
    100337999 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100337999 (MAPK10)
   05212 Pancreatic cancer
    100337999 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100337999 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100337999 (MAPK10)
   05161 Hepatitis B
    100337999 (MAPK10)
   05171 Coronavirus disease - COVID-19
    100337999 (MAPK10)
   05162 Measles
    100337999 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100337999 (MAPK10)
   05169 Epstein-Barr virus infection
    100337999 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100337999 (MAPK10)
   05135 Yersinia infection
    100337999 (MAPK10)
   05133 Pertussis
    100337999 (MAPK10)
   05152 Tuberculosis
    100337999 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100337999 (MAPK10)
   05142 Chagas disease
    100337999 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100337999 (MAPK10)
   05012 Parkinson disease
    100337999 (MAPK10)
   05016 Huntington disease
    100337999 (MAPK10)
   05017 Spinocerebellar ataxia
    100337999 (MAPK10)
   05020 Prion disease
    100337999 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    100337999 (MAPK10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100337999 (MAPK10)
   05418 Fluid shear stress and atherosclerosis
    100337999 (MAPK10)
   05415 Diabetic cardiomyopathy
    100337999 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100337999 (MAPK10)
   04936 Alcoholic liver disease
    100337999 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    100337999 (MAPK10)
   04931 Insulin resistance
    100337999 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100337999 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100337999 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100337999 (MAPK10)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100337999 (MAPK10)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100337999 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 100337999
NCBI-ProteinID: XP_017202927
Ensembl: ENSOCUG00000010663
LinkDB
Position
15:complement(65750826..66072993)
AA seq 464 aa
MSLHFLYYCSEPTLDVKLAFCQGFDKQVDVSYIAKYYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACSSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIDEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLHPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaaccttggatgtgaaacttgccttt
tgtcagggatttgataaacaagtggatgtgtcatatattgccaaatattacaacatgagc
aaaagcaaagtggacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaacctaaagcctattggctctggggctcagggaatagtttgtgct
gcctatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggaattccaa
gatgtctacctggtcatggaactgatggacgccaacttgtgtcaggtgattcagatggaa
ttagaccatgagcgaatgtcttacctgctctatcagatgttgtgtggcattaagcacctc
cactctgctggaattatccacagggatttaaaacccagtaacattgtagtcaaatccgat
tgcacgttgaaaatcctcgactttggactggccaggacagcatgctccagcttcatgatg
actccgtatgtggtgacacgttattacagagccccagaggtcatcctgggaatgggctac
aaggagaatgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatatcgaccagtggaacaaagtcattgagcaactagga
acgccgtgtccagaattcatgaagaaattgcagcctacagtaagaaactatgtggagaac
cggcccaagtatgcgggactcaccttccccaagctctttccagattccctcttcccagca
gactccgagcacaataagctcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaagaggatatcggtggatgacgccttacagcatccttacatcaac
gtctggtatgaccccgccgaagtggaagcgcctccacctcagatatacgacaagcagctg
gatgaaagagaacacaccattgacgagtggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaagaatggcgtagtgaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccatccatcctcgtctgtcaacgacatctcctccatgtcc
accgaccagaccctggcgtctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

KEGG   Oryctolagus cuniculus (rabbit): 100338341
Entry
100338341         CDS       T03373                                 
Symbol
EIF5A, eIF-4D, eIF-5A, eIF-5A-1, eIF-5A1
Name
(RefSeq) eukaryotic translation initiation factor 5A
  KO
K04448  transcription factor AP-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04024  cAMP signaling pathway
ocu04137  Mitophagy - animal
ocu04210  Apoptosis
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05224  Breast cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100338341 (EIF5A)
   04012 ErbB signaling pathway
    100338341 (EIF5A)
   04310 Wnt signaling pathway
    100338341 (EIF5A)
   04668 TNF signaling pathway
    100338341 (EIF5A)
   04024 cAMP signaling pathway
    100338341 (EIF5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100338341 (EIF5A)
  09143 Cell growth and death
   04210 Apoptosis
    100338341 (EIF5A)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100338341 (EIF5A)
   04530 Tight junction
    100338341 (EIF5A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100338341 (EIF5A)
   04621 NOD-like receptor signaling pathway
    100338341 (EIF5A)
   04625 C-type lectin receptor signaling pathway
    100338341 (EIF5A)
   04660 T cell receptor signaling pathway
    100338341 (EIF5A)
   04658 Th1 and Th2 cell differentiation
    100338341 (EIF5A)
   04659 Th17 cell differentiation
    100338341 (EIF5A)
   04657 IL-17 signaling pathway
    100338341 (EIF5A)
   04662 B cell receptor signaling pathway
    100338341 (EIF5A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100338341 (EIF5A)
   04915 Estrogen signaling pathway
    100338341 (EIF5A)
   04921 Oxytocin signaling pathway
    100338341 (EIF5A)
   04926 Relaxin signaling pathway
    100338341 (EIF5A)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100338341 (EIF5A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338341 (EIF5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338341 (EIF5A)
   05207 Chemical carcinogenesis - receptor activation
    100338341 (EIF5A)
   05208 Chemical carcinogenesis - reactive oxygen species
    100338341 (EIF5A)
   05203 Viral carcinogenesis
    100338341 (EIF5A)
   05231 Choline metabolism in cancer
    100338341 (EIF5A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100338341 (EIF5A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100338341 (EIF5A)
   05211 Renal cell carcinoma
    100338341 (EIF5A)
   05224 Breast cancer
    100338341 (EIF5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100338341 (EIF5A)
   05170 Human immunodeficiency virus 1 infection
    100338341 (EIF5A)
   05161 Hepatitis B
    100338341 (EIF5A)
   05171 Coronavirus disease - COVID-19
    100338341 (EIF5A)
   05162 Measles
    100338341 (EIF5A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100338341 (EIF5A)
   05169 Epstein-Barr virus infection
    100338341 (EIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100338341 (EIF5A)
   05135 Yersinia infection
    100338341 (EIF5A)
   05133 Pertussis
    100338341 (EIF5A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100338341 (EIF5A)
   05142 Chagas disease
    100338341 (EIF5A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100338341 (EIF5A)
   05321 Inflammatory bowel disease
    100338341 (EIF5A)
  09165 Substance dependence
   05030 Cocaine addiction
    100338341 (EIF5A)
   05031 Amphetamine addiction
    100338341 (EIF5A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100338341 (EIF5A)
   05418 Fluid shear stress and atherosclerosis
    100338341 (EIF5A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100338341 (EIF5A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100338341 (EIF5A)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100338341 (EIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100338341 (EIF5A)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100338341 (EIF5A)
SSDB
Motif
Pfam: Jun
Other DBs
NCBI-GeneID: 100338341
NCBI-ProteinID: XP_017204364
LinkDB
Position
19:complement(11833864..11836660)
AA seq 278 aa
MSAKMETTFYDDALNASFLQTESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGGGGSGSGLGGSGWARGERTGSSQCVRA
SWTRNFLKWQMIWTSRQEMQGPQPPSQCSAQHYVRMALWCSKAGHVRSSRCLLRRLASMA
MPRSTWSVLTSLLGRNMKISARQLIIWMSPTLKGMTSS
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagtgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag
accgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctcatc
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgag
ctgcacagccagaacacgctgcccagcgtcacgtccgcggcgcagccggtcagcggggcg
ggcatggtggctccggccgtggcctcggtggcgggcggcggcggcggcagcggcagcggg
ctcggaggcagcggttgggctcgcggcgagcggaccgggtcgagtcagtgcgttcgcgcg
agttggactcgaaacttcttaaaatggcagatgatttggacttcgagacaggagatgcag
gggcctcagccaccttcccaatgcagtgctcagcattacgtaagaatggctttgtggtgc
tcaaaggccggccatgtaagatcgtcgagatgtctacttcgaagactggcaagcatggcc
atgccaaggtccacctggtcggtattgacatctttactgggaagaaatatgaagatatct
gcccgtcaactcataatatggatgtccccaacattaaaaggaatgacttccagctga

KEGG   Oryctolagus cuniculus (rabbit): 100342664
Entry
100342664         CDS       T03373                                 
Symbol
MAPK9
Name
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04926  Relaxin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04936  Alcoholic liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100342664 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100342664 (MAPK9)
   04012 ErbB signaling pathway
    100342664 (MAPK9)
   04014 Ras signaling pathway
    100342664 (MAPK9)
   04310 Wnt signaling pathway
    100342664 (MAPK9)
   04668 TNF signaling pathway
    100342664 (MAPK9)
   04068 FoxO signaling pathway
    100342664 (MAPK9)
   04071 Sphingolipid signaling pathway
    100342664 (MAPK9)
   04024 cAMP signaling pathway
    100342664 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100342664 (MAPK9)
   04137 Mitophagy - animal
    100342664 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    100342664 (MAPK9)
   04215 Apoptosis - multiple species
    100342664 (MAPK9)
   04217 Necroptosis
    100342664 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100342664 (MAPK9)
   04530 Tight junction
    100342664 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100342664 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100342664 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100342664 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100342664 (MAPK9)
   04660 T cell receptor signaling pathway
    100342664 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    100342664 (MAPK9)
   04659 Th17 cell differentiation
    100342664 (MAPK9)
   04657 IL-17 signaling pathway
    100342664 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    100342664 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100342664 (MAPK9)
   04920 Adipocytokine signaling pathway
    100342664 (MAPK9)
   04912 GnRH signaling pathway
    100342664 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100342664 (MAPK9)
   04917 Prolactin signaling pathway
    100342664 (MAPK9)
   04926 Relaxin signaling pathway
    100342664 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    100342664 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100342664 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    100342664 (MAPK9)
   04722 Neurotrophin signaling pathway
    100342664 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100342664 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100342664 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342664 (MAPK9)
   05208 Chemical carcinogenesis - reactive oxygen species
    100342664 (MAPK9)
   05231 Choline metabolism in cancer
    100342664 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100342664 (MAPK9)
   05212 Pancreatic cancer
    100342664 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342664 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    100342664 (MAPK9)
   05161 Hepatitis B
    100342664 (MAPK9)
   05171 Coronavirus disease - COVID-19
    100342664 (MAPK9)
   05162 Measles
    100342664 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100342664 (MAPK9)
   05169 Epstein-Barr virus infection
    100342664 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100342664 (MAPK9)
   05135 Yersinia infection
    100342664 (MAPK9)
   05133 Pertussis
    100342664 (MAPK9)
   05152 Tuberculosis
    100342664 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100342664 (MAPK9)
   05142 Chagas disease
    100342664 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100342664 (MAPK9)
   05012 Parkinson disease
    100342664 (MAPK9)
   05016 Huntington disease
    100342664 (MAPK9)
   05017 Spinocerebellar ataxia
    100342664 (MAPK9)
   05020 Prion disease
    100342664 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    100342664 (MAPK9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100342664 (MAPK9)
   05418 Fluid shear stress and atherosclerosis
    100342664 (MAPK9)
   05415 Diabetic cardiomyopathy
    100342664 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100342664 (MAPK9)
   04936 Alcoholic liver disease
    100342664 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    100342664 (MAPK9)
   04931 Insulin resistance
    100342664 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100342664 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100342664 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100342664 (MAPK9)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100342664 (MAPK9)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100342664 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100342664
NCBI-ProteinID: XP_002721353
Ensembl: ENSOCUG00000015542
UniProt: A0A5F9CRG3
LinkDB
Position
Un
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaacgttc
actgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaatcgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcaaaatcaaactcatgcaaagagagcttatcgagaacttgtcctgttaaagtgtgtc
aatcataaaaacataattagtttgttaaatgtatttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggtgatggaattaatggatgctaacctatgtcaggtgattcac
atggagctggaccatgagagaatgtcctaccttctttaccagatgctttgtggcatcaaa
catctgcactcagccgggataattcacagagacttgaagcctagcaacattgtagtgaaa
tcagactgcacccttaagatccttgattttggcctggcccggacagcgtgcaccaatttc
atgatgaccccctatgtggtaacgcggtattatcgggcacctgaagtcatcctgggtatg
ggctacaaagagaacgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatattgatcagtggaacaaagtcattgagcag
ctaggaacaccgtccgcagagttcatgaagaaacttcagccaactgtgaggaactatgtg
gaaaacagaccgaagtaccctggaatcaaatttgaagagctctttccagattggatattc
ccatcagaatcagaacgagacaaaataaaaacgagtcaagccagggatctgttatcaaaa
atgttggtgatcgaccccgacaagcggatctctgtggacgaggctctgcgccacccgtac
atcactgtctggtacgatcctgccgaggcagaggcgccaccacctcagatttacgatgcc
caattggaagaaagagaacatgcaattgaggagtggaaagagctaatttacaaagaagta
atggactgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttcccagtcgtcatctatcaatgacatctcatccatgtcc
acggagcagacactggcctcagacacagacagcagtcttgatgcctcaacaggacctctg
gaaggttgtcgatga

KEGG   Oryctolagus cuniculus (rabbit): 100346929
Entry
100346929         CDS       T03373                                 
Symbol
MAPK8
Name
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04926  Relaxin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04936  Alcoholic liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100346929 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100346929 (MAPK8)
   04012 ErbB signaling pathway
    100346929 (MAPK8)
   04014 Ras signaling pathway
    100346929 (MAPK8)
   04310 Wnt signaling pathway
    100346929 (MAPK8)
   04668 TNF signaling pathway
    100346929 (MAPK8)
   04068 FoxO signaling pathway
    100346929 (MAPK8)
   04071 Sphingolipid signaling pathway
    100346929 (MAPK8)
   04024 cAMP signaling pathway
    100346929 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100346929 (MAPK8)
   04137 Mitophagy - animal
    100346929 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100346929 (MAPK8)
   04215 Apoptosis - multiple species
    100346929 (MAPK8)
   04217 Necroptosis
    100346929 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100346929 (MAPK8)
   04530 Tight junction
    100346929 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100346929 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100346929 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100346929 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100346929 (MAPK8)
   04660 T cell receptor signaling pathway
    100346929 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100346929 (MAPK8)
   04659 Th17 cell differentiation
    100346929 (MAPK8)
   04657 IL-17 signaling pathway
    100346929 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100346929 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100346929 (MAPK8)
   04920 Adipocytokine signaling pathway
    100346929 (MAPK8)
   04912 GnRH signaling pathway
    100346929 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100346929 (MAPK8)
   04917 Prolactin signaling pathway
    100346929 (MAPK8)
   04926 Relaxin signaling pathway
    100346929 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    100346929 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100346929 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100346929 (MAPK8)
   04722 Neurotrophin signaling pathway
    100346929 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100346929 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100346929 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346929 (MAPK8)
   05208 Chemical carcinogenesis - reactive oxygen species
    100346929 (MAPK8)
   05231 Choline metabolism in cancer
    100346929 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100346929 (MAPK8)
   05212 Pancreatic cancer
    100346929 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346929 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100346929 (MAPK8)
   05161 Hepatitis B
    100346929 (MAPK8)
   05171 Coronavirus disease - COVID-19
    100346929 (MAPK8)
   05162 Measles
    100346929 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100346929 (MAPK8)
   05169 Epstein-Barr virus infection
    100346929 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100346929 (MAPK8)
   05135 Yersinia infection
    100346929 (MAPK8)
   05133 Pertussis
    100346929 (MAPK8)
   05152 Tuberculosis
    100346929 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100346929 (MAPK8)
   05142 Chagas disease
    100346929 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100346929 (MAPK8)
   05012 Parkinson disease
    100346929 (MAPK8)
   05016 Huntington disease
    100346929 (MAPK8)
   05017 Spinocerebellar ataxia
    100346929 (MAPK8)
   05020 Prion disease
    100346929 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    100346929 (MAPK8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100346929 (MAPK8)
   05418 Fluid shear stress and atherosclerosis
    100346929 (MAPK8)
   05415 Diabetic cardiomyopathy
    100346929 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100346929 (MAPK8)
   04936 Alcoholic liver disease
    100346929 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    100346929 (MAPK8)
   04931 Insulin resistance
    100346929 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100346929 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100346929 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100346929 (MAPK8)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100346929 (MAPK8)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100346929 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100346929
NCBI-ProteinID: XP_002722716
Ensembl: ENSOCUG00000002873
UniProt: G1TPJ7
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFERLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAPA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagatcggagattctacattc
acagtcctgaagcgatatcagaatctaaaacctataggttctggagctcaaggaatagtc
tgtgcagcttatgatgccattcttgaaagaaatgttgccatcaagaagctaagccggccg
tttcagaatcaaacgcatgctaagagggcctacagagagctggttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatctctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcgaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactccgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaaaatccttgactttggactggccaggactgcaggaacaagcttt
atgatgacgccttatgtggtgactcgctactacagagcgcctgaggtcatcctgggcatg
ggctacaaggagaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
ctgggaacaccatgtcctgagttcatgaagaaactgcaaccaacagtaaggacttacgtg
gaaaacagacctaagtatgccggatatagctttgagaggctcttccccgatgtgcttttc
ccagctgactcggaacacaacaagcttaaagccagtcaggcaagggatttgctctctaaa
atgctggtgatagatgcatctaagaggatctctgtagacgaagctctccagcacccatac
atcaatgtctggtacgatccctctgaagcagaagccccaccaccaaagattcctgacaaa
cagttagacgaaagggaacacacgatagaagaatggaaagaattgatatacaaggaagtg
atggatttggaagaaagaaccaagaatggagttatacgagggcagccctctcctttaggt
gcagcagtgatcagtggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagacccgactttggcctcggatacagacagcagtctggaagccccagct
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system