KEGG   Oryctolagus cuniculus (rabbit): 100008874
Entry
100008874         CDS       T03373                                 
Symbol
CX3CR1
Name
(RefSeq) C-X3-C motif chemokine receptor 1
  KO
K04192  CX3C chemokine receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008874 (CX3CR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008874 (CX3CR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100008874 (CX3CR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100008874 (CX3CR1)
   04050 Cytokine receptors [BR:ocu04050]
    100008874 (CX3CR1)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CX3C Chemokine
    100008874 (CX3CR1)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CX3C Chemokine
   100008874 (CX3CR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100008874
NCBI-ProteinID: NP_001075603
UniProt: Q2KTE1
LinkDB
Position
9:4398408..4415221
AA seq 356 aa
MTTLYSDWATESFEYDESSEACFIGDIVAFGTIFLSIFYSLVFAFGLVGNLLVVCALTSS
RKPKSITDIYLLNLALSDLLFVATLPFWTHYVISEQGFHNAVCKLTTALFFIGFFGGIFF
ITVISIDRYMAIVLAANSINNRTVQHGVTTSLGVWAAAILVAAPQFMFTKQKGNECLGDY
PEVLQDIWPVLRNTEANFLGFLLPVLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIV
FFLFWTPYNVMIFLETLKLYGFFPNCDMKRDLRLALSVTETVAFSHCCLNPLIYAFAGQK
FRRYLRHLSRKCQAVLCGRPVHVSFSPSESQRSRQESIVSSNFTHYTSDGDASLLL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaccaccctctactctgactgggctaccgaaagctttgagtacgatgagtcttcagaa
gcctgtttcataggggacatcgtggccttcggaaccatcttcctgtccatattctactcc
ctcgtctttgcctttggcttggtggggaacttgttggtggtatgtgccctcaccagcagc
cggaagcccaagagcatcacagacatttacctcctcaacctggccttgtctgacctgctc
ttcgtggccaccctgcccttctggactcactatgtgataagtgaacaaggcttccacaac
gccgtgtgcaaactcacgacggctctgttcttcatcggcttctttgggggcatattcttc
atcactgtcatcagcatcgataggtacatggccattgtcctggccgccaactccattaac
aaccggactgtgcagcatggcgtcaccaccagcctcggcgtctgggcagcagccatcctg
gtggcggctccccagttcatgttcacaaagcaaaaaggaaacgaatgtctgggtgactac
cccgaggtcctgcaggacatctggcctgtgcttcggaacacagaagccaacttccttggc
ttcctgctccccgtacttatcatgagttactgctacttccgaatcatccagaccctgttt
tcctgcaagaaccacaagaaagccaaagccatcaaactcatcctactggtagtcatcgtg
tttttcctcttctggacaccctacaatgttatgattttcctggagacgctcaagctctat
ggcttctttcccaactgtgacatgaagagggacctgaggttggccctcagtgtgaccgag
acagtggcatttagccactgttgcctcaatccccttatctatgcatttgctggacagaag
ttcagacgataccttcgccacctgtccaggaaatgccaggctgtcctgtgcggccgtcca
gtccacgtcagtttctccccatctgagtcgcagaggagcaggcaggaaagcattgtcagc
agcaatttcactcactacacgagtgatggagacgcgtccctccttctctga

DBGET integrated database retrieval system