Oryctolagus cuniculus (rabbit): 100008875 Help Entry 100008875         CDS       T03373                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01524   Platinum drug resistance ocu04014   Ras signaling pathway ocu04064   NF-kappa B signaling pathway ocu04115   p53 signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04621   NOD-like receptor signaling pathway ocu04630   JAK-STAT signaling pathway ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05022   Pathways of neurodegeneration - multiple diseases ocu05145   Toxoplasmosis ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05168   Herpes simplex virus 1 infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05202   Transcriptional misregulation in cancer ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05222   Small cell lung cancer ocu05225   Hepatocellular carcinoma ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100008875 (BCL2L1)    04630 JAK-STAT signaling pathway     100008875 (BCL2L1)    04064 NF-kappa B signaling pathway     100008875 (BCL2L1)    04151 PI3K-Akt signaling pathway     100008875 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100008875 (BCL2L1)    04137 Mitophagy - animal     100008875 (BCL2L1)   09143 Cell growth and death    04215 Apoptosis - multiple species     100008875 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100008875 (BCL2L1)    05202 Transcriptional misregulation in cancer     100008875 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     100008875 (BCL2L1)    05225 Hepatocellular carcinoma     100008875 (BCL2L1)    05220 Chronic myeloid leukemia     100008875 (BCL2L1)    05222 Small cell lung cancer     100008875 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100008875 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     100008875 (BCL2L1)    05162 Measles     100008875 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100008875 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     100008875 (BCL2L1)    05014 Amyotrophic lateral sclerosis     100008875 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     100008875 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100008875 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100008875 (BCL2L1)    01524 Platinum drug resistance     100008875 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ocu01009]     100008875 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100008875 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ocu02000]     100008875 (BCL2L1) Protein phosphatases and associated proteins [BR:ocu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100008875 (BCL2L1) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100008875 (BCL2L1) Transporters [BR:ocu02000]  Other transporters   Pores ion channels [TC:1]    100008875 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100008875 NCBI-ProteinID:  NP_001075604 Ensembl:  ENSOCUG00000003201 UniProt:  Q9MYW4 LinkDB All DBs Position 4:15157462..15215700 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTGPEMETPSAINGNPAWHPA DSPAVNGATGHSSSLDAREVIPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcgcagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccggaaggg actggaccagagatggagacccccagtgccatcaatggcaacccagcctggcacccggcg gacagccccgcggtgaacggagccactggccacagcagcagtttggatgcccgggaggtg atccccatgacagcagtgaagcaggctctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaagtagtgaacgaactcttccgggatggggtgaactggggccgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtggacaaggagatggag gtattggtgagtcggatcgcggcgtggatggccacttacctgaatgaccacctggagccc tggatccaggagaacggcggctgggacacgtttgtggaactctacggcaacaacgcagca gccgagagccgcaagggccaggagcgcttcaaccgctggttcctgacgggcatgaccgtg gctggcgtggttctgctgggctccctcttcagtcggaaatga

DBGET integrated database retrieval system