KEGG   Oryctolagus cuniculus (rabbit): 100008898
Entry
100008898         CDS       T03373                                 
Symbol
ITGB1
Name
(RefSeq) integrin subunit beta 1
  KO
K05719  integrin beta 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04145  Phagosome
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04512  ECM-receptor interaction
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05222  Small cell lung cancer
ocu05410  Hypertrophic cardiomyopathy
ocu05412  Arrhythmogenic right ventricular cardiomyopathy
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100008898 (ITGB1)
   04151 PI3K-Akt signaling pathway
    100008898 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100008898 (ITGB1)
   04514 Cell adhesion molecules
    100008898 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100008898 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008898 (ITGB1)
   04530 Tight junction
    100008898 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100008898 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100008898 (ITGB1)
   04670 Leukocyte transendothelial migration
    100008898 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    100008898 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008898 (ITGB1)
   05205 Proteoglycans in cancer
    100008898 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100008898 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100008898 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100008898 (ITGB1)
   05133 Pertussis
    100008898 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    100008898 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100008898 (ITGB1)
   05140 Leishmaniasis
    100008898 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100008898 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100008898 (ITGB1)
   05414 Dilated cardiomyopathy
    100008898 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008898 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008898 (ITGB1)
   04515 Cell adhesion molecules [BR:ocu04515]
    100008898 (ITGB1)
   04090 CD molecules [BR:ocu04090]
    100008898 (ITGB1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100008898 (ITGB1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100008898 (ITGB1)
Cell adhesion molecules [BR:ocu04515]
 Integrins
  Integrin beta subunits
   100008898 (ITGB1)
CD molecules [BR:ocu04090]
 Proteins
  100008898 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100008898
NCBI-ProteinID: XP_002721235
Ensembl: ENSOCUG00000003623
UniProt: A0A5F9C3C4
LinkDB
Position
Un
AA seq 798 aa
MNLQLIFWIGLLGSICCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSRDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRVTSDF
RIGFGSFVEKTVMPYISTTPAKLKNPCTSEQNCTSPFSYKNVLSLTDRGEEFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLEHNEYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVHFEISITSNQCPVKHSETIKIKPLGFTEEVEVVLEFICKCECQDTGIPRSPQCHDG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCM
ATNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDK
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggactgctcggttcaatttgctgtgtgtttggc
caaacagatgaaaatagatgtttaaaagcaaatgctaaatcgtgtggagaatgcatccag
gcaggccccaattgtgggtggtgcacaaattcgacgtttttgcaagaaggaatgcctact
tctgcacgatgtgatgacttagaagccttgaaaaagaaaggctgccatccagacgacata
gagaatcccagaggttccagagacataaagaaaaataagaatgtcaccaaccgtagcaaa
ggcacagcagagaagctgcagccggaggatatcactcagatccagccccagcagctggtt
ctgcagctgcgatcaggggagccccagacgttcacgttgaagttcaagcgtgctgaagac
taccccatcgacctctactacctcatggacctctcctactccatgaaagatgatctggag
aacgtcaagagtctcgggacggatctgatgaatgagatgaggagggtgacttcagacttc
cgaattgggtttggctcctttgtggagaaaaccgtgatgccttacattagcactacgcct
gccaagctcaagaacccttgcacgagtgagcagaactgcaccagccccttcagctacaag
aacgtgctcagcctcacagacagaggggaggagttcaacgagctcgtcgggaagcagcgc
atttctggaaatttggattctccggaaggtggttttgatgcaatcatgcaggttgcggtc
tgtgggtcgctgatcggctggaggaacgtcactcggctgctggtgttctccacggacgcg
gggttccactttgctggggacgggaaacttggtggtattgtcttacccaacgatggacag
tgccacctggaacacaacgagtacaccatgagccactattacgactacccttctattgcc
cacctcgtccagaaactcagtgaaaataacattcagactatttttgcagttactgaagaa
tttcagcctgtttacaaggaactgaaaaacttgatccctaagtcagcagtgggaacgttg
tctgcaaactccagcaatgtcatccagctgatcattgatgcctacaactccctttcttca
gaagtcattttggaaaacagcaaattgccagaaggagtaacgataaattacaaatcttac
tgcaagaacggggtgaatggcacaggggagaacggaaggaagtgctccaatatctccatt
ggagatgaggttcactttgaaatcagcataacttcaaatcagtgtccagttaagcattct
gaaaccattaaaatcaagcctctgggcttcaccgaggaggtggaggtggtccttgagttc
atctgcaagtgtgagtgccaggacacaggcatcccaagaagtccccagtgccacgatggg
aatggcacgtttgagtgtggggcttgcaggtgcaacgagggacgtgtaggcagacactgt
gaatgcagtacagatgaggtgaacagtgaagacatggatgcttactgcaggaaagaaaac
agttcagaaatctgcagcaacaacggggagtgcgtctgtgggcagtgtgtgtgcaggaag
agggacaacacaaatgaaatctattctggcaaattctgcgagtgtgataatttcaactgt
gatcgctccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaatcctaactacaccggcagtgcgtgcgactgttctctggatacgacgtcttgcatg
gccacaaacgggcagatctgtaatggccggggtatctgcgagtgtggcgtctgcaagtgt
acagatcccaagtttcaagggcaaacctgtgagatgtgccagacctgcctgggtgtctgt
gcggagcacaaagaatgtgtccagtgccgagccttcaataaaggagaaaagaaagacaaa
tgtgcacaggaatgctcacatttcaacatcaccaaggtggaaaatcgggacaagctgccc
cagccaggccaggtggaccccctgtcccactgtaaggagaaggatgtggacgactgctgg
ttctacttcacgtactcggtgaacgggaacaacgaggccatcgtgcacgtcgtggagact
ccagagtgccccactggtcctgacatcattccaattgtcgctggtgtggtggctggcatt
gttcttattggccttgcactgctgctgatttggaagctcttgatgatcattcatgacaga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgctgtgacaactgtggtcaaccccaagtatgagggaaaatga

KEGG   Oryctolagus cuniculus (rabbit): 100346103
Entry
100346103         CDS       T03373                                 
Symbol
ITGA4
Name
(RefSeq) integrin subunit alpha 4
  KO
K06483  integrin alpha 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04512  ECM-receptor interaction
ocu04514  Cell adhesion molecules
ocu04640  Hematopoietic cell lineage
ocu04670  Leukocyte transendothelial migration
ocu04672  Intestinal immune network for IgA production
ocu04810  Regulation of actin cytoskeleton
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05165  Human papillomavirus infection
ocu05410  Hypertrophic cardiomyopathy
ocu05412  Arrhythmogenic right ventricular cardiomyopathy
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100346103 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100346103 (ITGA4)
   04514 Cell adhesion molecules
    100346103 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100346103 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100346103 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100346103 (ITGA4)
   04670 Leukocyte transendothelial migration
    100346103 (ITGA4)
   04672 Intestinal immune network for IgA production
    100346103 (ITGA4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100346103 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100346103 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100346103 (ITGA4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100346103 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100346103 (ITGA4)
   05414 Dilated cardiomyopathy
    100346103 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100346103 (ITGA4)
   04515 Cell adhesion molecules [BR:ocu04515]
    100346103 (ITGA4)
   04090 CD molecules [BR:ocu04090]
    100346103 (ITGA4)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100346103 (ITGA4)
  Exosomal proteins of other cancer cells
   100346103 (ITGA4)
Cell adhesion molecules [BR:ocu04515]
 Integrins
  Integrin alpha subunits
   100346103 (ITGA4)
CD molecules [BR:ocu04090]
 Proteins
  100346103 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 100346103
NCBI-ProteinID: XP_002712273
Ensembl: ENSOCUG00000003008
UniProt: G1TY34
Structure
LinkDB
Position
7:121433522..121544431
AA seq 1031 aa
MAGEARRGSGSRGAAVREAVMLLLCLGIPTGRPYNLDTESALLYQGPPGTLFGYSVALHS
HGSNRWLIVGAPTANWLANASVVSPGAIYRCRIGQNPGQTCEQLQLGSPTGEPCGKTCLE
ERDNEWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPIGVCYGMPSDLRTELSKRM
APCYQDYIRKFGENFASCQAGISSFYTEDLIVMGAPGSFYWTGSLFVYNITTNKYKAFWD
KDNQVKFGSYLGYSVGAGHFWSRHTTEVVGGAPQHEQIGKAYIFSIDARELNILYEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNEMETELIG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISPTFSQRIEG
LQVSKSLSMFGQSISGQIDADNNGYVDVAVGAFRSNSAVLLRTRPVVIVDASLRHPEAVN
RTKFDCIENGLPSVCIDLKLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPSRFYFSSNGT
SDVITGSIQVSSKATNCRTHQAFMRKDVRDILTPVQIEAAYRLGQHVLTKRSAEEFPPLQ
PILQQKKEKDVIKKMINFARFCAHENCTADLQVSAKIGFLKPHENKTYLAVGGMKMLMLN
VSLFNAGDDAYGTTLHIRLPMGLYFIKILDLEEKQINCEVTESSGPVKLDCSVGYIYVDH
LSRIDISFLLDVSSLSRAEEDVNITVHATCENEGEMDTLKHNKVTLAIPLRYEVMLTAHG
FVNPTSFVYGSSEENDHETCMTEKMNLTFHVINTGNSMAPNVSMEIMVPNSFMPQTNKLF
NILDVQMTTGECFFETYQRECALEQPKGAMETLKGIFTFLSKTDKRLLYCIKADPHCLNV
LCNFGKMESGKEASVHIQLEGRPSILEMDETSSLKFEIRATAFPEPHPKVVELNKEENVA
HVLLEGLHHQRPKRHFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYVKSNNDN
NT seq 3096 nt   +upstreamnt  +downstreamnt
atggctggggaagcgaggcgtggatctggctcccgaggggccgccgtccgggaggcggtg
atgctgttgctgtgcctggggatcccgaccgggcgcccctacaacctcgacaccgagagc
gcgctgctctaccagggccccccgggcacgctgttcggctactctgtcgcgctgcacagc
cacgggtcgaatcgatggctcatagtgggggcgcccactgccaactggctcgccaacgct
tcagtggtcagtcctggggcgatttacagatgcaggatcggacagaatccgggccagacg
tgcgaacagctccagctgggtagccctactggagaaccttgtgggaagacttgtctggag
gagagagataatgagtggctgggcgtcactctttccagacagccaggagaaaacggatcc
atcgtgacttgtgggcatcgatggaaaaatatattttacataaagaatgagaataagctc
cccattggtgtttgctatggaatgccctctgatttacgaacagaactgagtaaaagaatg
gctccatgctatcaagattatataagaaaatttggagaaaactttgcatcatgtcaagct
ggaatatctagtttttacacagaggatttaattgtaatgggagcacctggatcattttat
tggactggttctctttttgtctacaatataactacaaataaatacaaggctttttgggac
aaagataatcaagtaaaatttggaagttatttagggtactcagttggagctggtcacttc
tggagtcgacatacaacagaagtagttggaggagctcctcaacatgaacagattggaaaa
gcatatatattcagcattgacgccagagaactaaatatcttatatgaaatgaaaggtaaa
aagctcggctcatattttggagcctctgtgtgtgctgtggacctcaatgcggatggcttc
tcagacctactcgtaggagctcctatgcagagcaccatcagggaggaaggaagagtgttc
gtgtacatcaactcgggctcgggagcagtaatgaatgaaatggaaacagaactcattgga
agtgacaaatatgctgcaagatttggggaatctatagttaatcttggtgacattgacaat
gatggctttgaagatgttgctattggagctccacaggaagatgacttgagaggtgctatc
tacatttacaatggccgagcagacggaatctcgccaaccttctcacagagaattgaaggg
cttcaagtcagcaaatcattaagtatgtttggacagtcgatatcaggacaaattgatgca
gataacaacggatatgtagatgtagcagttggtgcttttcgctctaattctgctgtgttg
ctaaggaccagacctgtagtgattgttgatgcttctttaagacacccagaggcagtaaat
agaacaaaatttgattgcattgaaaatggactgccttctgtgtgcattgatctaaaactt
tgcttctcatataaaggcaaagaggttccaggctatattgttttgttttataacatgagt
ttggatgtgaacagaaaggcagagtccccatcaagattttatttttcttccaatggcact
tctgatgtgattacaggaagcatacaagtatcgagcaaagctactaactgtaggacgcat
caagcatttatgcggaaagatgtgagggacatccttactccagttcagattgaagccgct
taccgcctggggcagcatgtcctcactaaacgaagtgcagaagaattcccaccactgcag
ccaattcttcagcagaagaaagaaaaagacgtgataaaaaaaatgataaactttgcaagg
ttttgtgctcatgaaaattgtactgctgatttacaggtttctgcaaaaattgggtttttg
aagccacatgaaaataaaacctaccttgctgttggaggcatgaagatgttaatgttgaat
gtgtcattgttcaatgctggagatgatgcttacggaacaactctgcacatcagactgccc
atggggctgtacttcattaagattttagacctggaagagaaacaaataaactgtgaagta
acagaaagctctggcccagtaaaacttgactgcagtgttggttatatctatgtagatcat
ctctcaaggatagatatcagcttcctcctggatgtgagttcactcagcagagcggaggag
gatgtcaacatcacagtgcacgccacatgtgaaaacgaaggggaaatggacactttgaag
cataacaaagtgactttagcaatacctctaaggtatgaggttatgctaactgctcatggg
tttgtcaacccaacttcctttgtgtatggatcaagtgaggaaaatgaccatgaaacatgc
atgacagagaaaatgaatctcacattccatgttattaacactggcaatagcatggctcca
aatgtaagcatggaaataatggtaccaaattcttttatgccccaaaccaataaactgttc
aacattttggatgtccagatgaccactggagaatgcttctttgaaacttatcaaagagaa
tgtgcattagagcagccaaagggtgccatggagaccttgaaaggcatattcacgttcttg
tcaaagactgataagaggctgttgtattgcataaaagctgacccacactgtttaaatgtg
ttatgtaattttgggaaaatggaaagtggaaaagaagccagtgttcacattcagctggaa
ggccggccgtccattttagaaatggatgagacatcgtcactcaagtttgaaataagggcg
acagcttttccagagccgcatccaaaagttgttgaattaaacaaggaagagaatgttgca
catgttttgctagaaggactacatcatcaaagacccaaacgtcattttactatagtgatt
atttctagcagtttgctacttggacttatagtacttctattgatttcatatgtcatgtgg
aaggctggcttctttaaaagacagtacaaatcaatcctacaagaagaaaatagaagagac
agttggagttatgtcaaaagcaataatgacaattaa

DBGET integrated database retrieval system