KEGG   Oryctolagus cuniculus (rabbit): 100008921
Entry
100008921         CDS       T03373                                 
Name
(RefSeq) platelet microbicidal protein 1
  KO
K05407  platelet factor 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008921
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008921
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100008921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008921
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008921
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100008921
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100008921
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100008921
NCBI-ProteinID: NP_001075631
UniProt: Q5VI85
LinkDB
Position
15:complement(76280877..76281825)
AA seq 106 aa
MSIPEASGAPRPRPSRGLLLLGLLLLLTVAAAASDDPKESEGDLHCVCVKTTSLVRPRHI
TNLELIKAGGHCPTAQLIATLKNGRKLCLDPQAALYKKVIKKLLKE
NT seq 321 nt   +upstreamnt  +downstreamnt
atgagcatcccagaggcgtctggtgccccccgaccccggccaagccgcggactgttgctc
ctgggactgctgctgctgctgactgtggcagccgccgccagtgatgacccaaaagaaagt
gagggagacctgcactgcgtgtgtgtgaagaccacttccctcgtccggcccaggcacatc
accaacctggagctgatcaaggccggaggccactgccccaccgcccaactgatagccacg
ctgaagaacgggaggaaactctgcctggatccgcaggcggccctgtacaagaaagtgatc
aagaaactcctgaaggagtag

DBGET integrated database retrieval system