Oryctolagus cuniculus (rabbit): 100008922 Help Entry 100008922         CDS       T03373                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ocu00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100008922 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100008922 (S100A10)    04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]     100008922 (S100A10) Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of microglial cells    100008922 (S100A10) Domain-containing proteins not elsewhere classified [BR:ocu04990]  EF-hand domain-containing proteins   S100 proteins    100008922 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  100008922 NCBI-ProteinID:  NP_001075632 Ensembl:  ENSOCUG00000005198 UniProt:  Q6SQH4 LinkDB All DBs Position 13:40483310..40486570 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggagcacgccatggaaaccatgatgtttacatttcacaaatttgct ggggataaaggctacttaacgaaggaagacctgcgcgtcctcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggctgtggacaaaataatgaaggacctagac cagtgccgagacggcaaagtggggttccagagcttcttctccctcattgccggcctcacc attgcatgcaatgactattttgtagtgcacatgaagcagaagggaaagaagtga

DBGET integrated database retrieval system