KEGG   Oryctolagus cuniculus (rabbit): 100008984
Entry
100008984         CDS       T03373                                 
Symbol
CCL4, ACT2
Name
(RefSeq) chemokine (C-C motif) ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100008984 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008984 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008984 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100008984 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    100008984 (CCL4)
   04062 Chemokine signaling pathway
    100008984 (CCL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100008984 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008984 (CCL4)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100008984 (CCL4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100008984
NCBI-ProteinID: NP_001075665
Ensembl: ENSOCUG00000026206
UniProt: P46632
LinkDB
Position
19:25035471..25045636
AA seq 92 aa
MKLGVTVLSVALLVAALCPPALSAPMGSDPPTACCFSYTLRKLPRHFVIDYFETTSLCSQ
PAVVFQTKKGRQVCANPSESWVQEYVDDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctcggcgtgaccgtcctctctgtcgccctgctggtggccgccctctgccctccc
gcactctctgcaccaatgggctcggacccccccaccgcctgctgcttctcgtacaccctg
cggaagcttcctcgtcacttcgtgatagattacttcgagaccaccagcctctgctcccag
ccagctgtggtattccagaccaaaaagggcaggcaagtctgtgccaaccctagcgagtcc
tgggtccaggagtacgtggatgacttggaactgaactga

KEGG   Oryctolagus cuniculus (rabbit): 100348266
Entry
100348266         CDS       T03373                                 
Symbol
CCL5
Name
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04668  TNF signaling pathway
ocu05020  Prion disease
ocu05142  Chagas disease
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100348266 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348266 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348266 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348266 (CCL5)
   04621 NOD-like receptor signaling pathway
    100348266 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    100348266 (CCL5)
   04062 Chemokine signaling pathway
    100348266 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100348266 (CCL5)
   05168 Herpes simplex virus 1 infection
    100348266 (CCL5)
   05163 Human cytomegalovirus infection
    100348266 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348266 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100348266 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    100348266 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100348266 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348266 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348266 (CCL5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348266 (CCL5)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100348266 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348266
NCBI-ProteinID: XP_017204526
Ensembl: ENSOCUG00000002848
UniProt: G1SIG1
LinkDB
Position
19:complement(24923608..24932154)
AA seq 91 aa
MEVSAAALAVLLTAAALCAPASASPYASDTTPCCFAYISRLLPRAHVTEYFYTSGKCSFP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaggtctccgccgccgccctcgccgtcctcctcaccgctgctgccctctgcgcacct
gcatctgcctccccatatgcctcggacaccacgccctgctgctttgcctacatctcccgc
ctgctgccccgggcccacgtcacggagtatttctataccagcggcaagtgctccttcccg
gcagttgtctttgtcaccaggaagaaccgccaggtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100348776
Entry
100348776         CDS       T03373                                 
Symbol
CCL3
Name
(RefSeq) C-C motif chemokine 3-like 1
  KO
K05408  C-C motif chemokine 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu05142  Chagas disease
ocu05163  Human cytomegalovirus infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348776 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348776 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348776 (CCL3)
   04062 Chemokine signaling pathway
    100348776 (CCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100348776 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348776 (CCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100348776 (CCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100348776 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348776 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348776 (CCL3)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348776 (CCL3)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100348776 (CCL3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348776
NCBI-ProteinID: XP_002719292
Ensembl: ENSOCUG00000000771
UniProt: G1SE13
LinkDB
Position
19:complement(25033918..25036115)
AA seq 93 aa
MKVSGVALAVLLCAMALSTQVFSIPLGADTPTACCFSYISRQIPYKFIADYFETSSQCSK
PGVIFLTKRGRQVCADISEAWVQGYINDLELNS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtctccggggttgccctcgccgtcctcctgtgcgccatggctctcagcacccag
gtcttctccataccacttggtgccgacaccccgaccgcctgctgcttctcctacatctcc
cgccagatcccctacaaattcatagccgactattttgagaccagcagccagtgctccaag
ccaggcgtcattttcctaaccaagagaggccggcaggtgtgcgctgacatcagtgaggcc
tgggtccagggctacatcaatgacctggaactgaattcctaa

DBGET integrated database retrieval system