Oryctolagus cuniculus (rabbit): 100008990 Help Entry 100008990         CDS       T03373                                  Symbol IL1B Name (RefSeq) interleukin-1 beta precursor   KO K04519   interleukin 1 beta Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01523   Antifolate resistance ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04064   NF-kappa B signaling pathway ocu04217   Necroptosis ocu04380   Osteoclast differentiation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04625   C-type lectin receptor signaling pathway ocu04640   Hematopoietic cell lineage ocu04657   IL-17 signaling pathway ocu04659   Th17 cell differentiation ocu04668   TNF signaling pathway ocu04750   Inflammatory mediator regulation of TRP channels ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04936   Alcoholic liver disease ocu04940   Type I diabetes mellitus ocu05010   Alzheimer disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05134   Legionellosis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05143   African trypanosomiasis ocu05144   Malaria ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05168   Herpes simplex virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05332   Graft-versus-host disease ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100008990 (IL1B)    04668 TNF signaling pathway     100008990 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100008990 (IL1B)    04620 Toll-like receptor signaling pathway     100008990 (IL1B)    04659 Th17 cell differentiation     100008990 (IL1B)    04657 IL-17 signaling pathway     100008990 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100008990 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     100008990 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100008990 (IL1B)    05164 Influenza A     100008990 (IL1B)    05162 Measles     100008990 (IL1B)    05163 Human cytomegalovirus infection     100008990 (IL1B)   09171 Infectious disease: bacterial    05135 Yersinia infection     100008990 (IL1B)    05133 Pertussis     100008990 (IL1B)    05134 Legionellosis     100008990 (IL1B)    05152 Tuberculosis     100008990 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100008990 (IL1B)    05144 Malaria     100008990 (IL1B)    05140 Leishmaniasis     100008990 (IL1B)    05142 Chagas disease     100008990 (IL1B)    05143 African trypanosomiasis     100008990 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     100008990 (IL1B)    05321 Inflammatory bowel disease     100008990 (IL1B)    05332 Graft-versus-host disease     100008990 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100008990 (IL1B)    05020 Prion disease     100008990 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     100008990 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100008990 (IL1B)    05418 Fluid shear stress and atherosclerosis     100008990 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100008990 (IL1B)    04936 Alcoholic liver disease     100008990 (IL1B)    04932 Non-alcoholic fatty liver disease     100008990 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     100008990 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100008990 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100008990 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100008990 (IL1B) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interleukins    100008990 (IL1B) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Cytokines    100008990 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  100008990 NCBI-ProteinID:  NP_001075670 Ensembl:  ENSOCUG00000023958 UniProt:  P14628 LinkDB All DBs Position 2:complement(98002306..98009317) Genome browser AA seq 268 aa AA seqDB search MATVPELTSEMMAYHSGNENDLFFEADGPNYMKSCFQDLDLCCPDEGIQLRISCQPYNKS FRQVLSVVVALEKLRQKAVPCPQAFQDDGLRTFFSLIFEEEPVLCNTWDDYSLECDAVRS LHCRLQDAQQKSLVLSGTYELKALHLNAENLNQQVVFSMSFVQGEESNDKIPVALGLRGK NLYLSCVMKDDKPTLQLESVDPNRYPKKKMEKRFVFNKIEIKDKLEFESAQFPNWYISTS QTEYMPVFLGNNSGGQDLIDFSMEFVSS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcaacagtacctgagctcaccagtgagatgatggcttaccacagtggcaatgaaaat gacctgttctttgaggccgatggtcccaattacatgaagagctgcttccaggacctggac ctctgctgtccagacgagggcatccagctgcgcatctcctgccaaccctacaacaagagc ttccggcaggtcttgtcagtcgttgtggctctggagaagctgcggcagaaagcagttccc tgcccacaggccttccaggatgacggcctgagaactttcttttccttaatctttgaagaa gaacccgtcctctgcaacacctgggatgactacagtcttgagtgtgatgcagtacgatca ctgcactgcaggctccaggatgcacaacagaaatccttggtgttgtctggcacgtatgag ctgaaagctctccacctcaatgcagagaatctgaaccaacaagtggtgttctccatgagt tttgtgcaaggagaagaaagtaacgacaagatacctgtggccttgggcctcagggggaag aatctgtacctgtcctgcgtgatgaaagacgataaacctaccctgcagctggagagtgta gaccccaaccgttacccaaagaagaagatggaaaaacgatttgtcttcaacaagatagaa atcaaggacaagctggaatttgagtctgcccagttccccaactggtacatcagcacctct cagacagagtacatgcccgtcttcctgggaaacaacagtggcggccaagacctaattgac ttcagcatggaattcgtgtcttcctaa

DBGET integrated database retrieval system