KEGG   Oryctolagus cuniculus (rabbit): 100009117
Entry
100009117         CDS       T03373                                 
Symbol
CNTF
Name
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100009117 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009117 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009117 (CNTF)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100009117 (CNTF)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 100009117
NCBI-ProteinID: NP_001075752
Ensembl: ENSOCUG00000005392
UniProt: P14188
LinkDB
Position
1:191686933..191688574
AA seq 199 aa
MAFMEHSALTPHRRELCSRTIWLARKIRSDLTALTESYVKHQGLNKNINLDSVDGVPMAS
TDQWSELTEAERLQENLQAYRTFHIMLARLLEDQQVHFTPAEGDFHQAIHTLLLQVAAFA
YQIEELMVLLECNIPPKDADGTPVIGGDGLFEKKLWGLKVLQELSHWTVRSIHDLRVISC
HQTGIPAHGSHYIANDKEM
NT seq 600 nt   +upstreamnt  +downstreamnt
atggctttcatggagcattcagcactgacccctcaccgccgggagctctgtagccgtacc
atctggctagcgaggaagattcgttcagacctgaccgctcttacggaatcttacgtgaag
catcagggcctgaacaagaacatcaacctggactctgtggatggagtaccaatggcaagc
actgatcagtggagtgagctgactgaggcagagcgactccaagagaacctccaagcttat
cggaccttccatattatgttggccaggcttttagaagaccagcaggtgcattttacccca
gctgaaggtgacttccatcaagctatacatacccttttactccaagttgctgccttcgct
taccagatagaggagttaatggtgctgttggaatgtaatatccctcccaaagatgctgat
gggacacctgtcattggaggtgatggtctctttgagaagaagctgtggggcctgaaggtg
ctacaagagctttcacactggacagtgagatccattcatgaccttcgtgtcatttcttgt
catcaaactggaatcccagcacatgggagccattatattgctaacgacaaggaaatgtag

DBGET integrated database retrieval system