Oryctolagus cuniculus (rabbit): 100009129 Help Entry 100009129         CDS       T03373                                  Symbol CXCL8 Name (RefSeq) interleukin-8 precursor   KO K10030   interleukin 8 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04064   NF-kappa B signaling pathway ocu04072   Phospholipase D signaling pathway ocu04218   Cellular senescence ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04936   Alcoholic liver disease ocu05132   Salmonella infection ocu05133   Pertussis ocu05134   Legionellosis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05144   Malaria ocu05146   Amoebiasis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05202   Transcriptional misregulation in cancer ocu05219   Bladder cancer ocu05323   Rheumatoid arthritis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100009129 (CXCL8)    04072 Phospholipase D signaling pathway     100009129 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100009129 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     100009129 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100009129 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100009129 (CXCL8)    04621 NOD-like receptor signaling pathway     100009129 (CXCL8)    04622 RIG-I-like receptor signaling pathway     100009129 (CXCL8)    04657 IL-17 signaling pathway     100009129 (CXCL8)    04062 Chemokine signaling pathway     100009129 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100009129 (CXCL8)    05202 Transcriptional misregulation in cancer     100009129 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     100009129 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     100009129 (CXCL8)    05171 Coronavirus disease - COVID-19     100009129 (CXCL8)    05164 Influenza A     100009129 (CXCL8)    05163 Human cytomegalovirus infection     100009129 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     100009129 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     100009129 (CXCL8)    05135 Yersinia infection     100009129 (CXCL8)    05133 Pertussis     100009129 (CXCL8)    05134 Legionellosis     100009129 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     100009129 (CXCL8)    05144 Malaria     100009129 (CXCL8)    05142 Chagas disease     100009129 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     100009129 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100009129 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100009129 (CXCL8)    04932 Non-alcoholic fatty liver disease     100009129 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     100009129 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100009129 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100009129 (CXCL8) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    100009129 (CXCL8) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Chemokines    100009129 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 DUF5527 Motif Other DBs NCBI-GeneID:  100009129 NCBI-ProteinID:  NP_001075762 Ensembl:  ENSOCUG00000011835 UniProt:  P19874 LinkDB All DBs Position 15:complement(73265161..73267893) Genome browser AA seq 101 aa AA seqDB search MNSKLAVALLATFLLSLTLCEAAVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPH CANSEIIVKLVDGRELCLDPKEKWVQKVVQIFLKRAEQQES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaactccaagctggctgtggctctcttggcaaccttcctgctgtctctgactctttgt gaagctgcagttctgacacggattggtacagagcttcgatgccagtgcataaagacacac tccacacctttccatcccaaatttatcaaagaattgagagtgattgagagtggacctcac tgtgcaaattcagaaatcattgtaaaacttgttgatggaagagaactctgcctggacccc aaggaaaagtgggtgcagaaggttgtgcaaatattcttgaagagggctgagcagcaagag tcataa

DBGET integrated database retrieval system