KEGG   Oryctolagus cuniculus (rabbit): 100009130
Entry
100009130         CDS       T03373                                 
Symbol
CCL2
Name
(RefSeq) chemokine (C-C motif) ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05144  Malaria
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100009130 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009130 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100009130 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100009130 (CCL2)
   04657 IL-17 signaling pathway
    100009130 (CCL2)
   04062 Chemokine signaling pathway
    100009130 (CCL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100009130 (CCL2)
   05164 Influenza A
    100009130 (CCL2)
   05168 Herpes simplex virus 1 infection
    100009130 (CCL2)
   05163 Human cytomegalovirus infection
    100009130 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100009130 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    100009130 (CCL2)
   05142 Chagas disease
    100009130 (CCL2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009130 (CCL2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009130 (CCL2)
   05418 Fluid shear stress and atherosclerosis
    100009130 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009130 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009130 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009130 (CCL2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100009130 (CCL2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100009130 (CCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100009130
NCBI-ProteinID: NP_001075763
Ensembl: ENSOCUG00000021710
UniProt: P28292
LinkDB
Position
19:23720271..23721930
AA seq 125 aa
MKVSATLLCLLLIAVAFSSHVLAQPDAVNSPVTCCYTFTNKTISVKRLMSYRRINSTKCP
KEAVIFMTKLAKGICADPKQKWVQDAIANLDKKMQTPKTLTSYSTTQEHTTNLSSTRTPS
TTTSL
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaggtctctgcaacgcttctgtgcctgctgctcatagcagtcgccttcagctcccat
gtgcttgcccagccagatgccgtgaattccccagtcacctgctgctatacattcaccaac
aagaccatctcagtgaagaggctaatgagctatagaagaatcaacagcaccaagtgtccc
aaagaagctgtgatcttcatgaccaaactggccaaggggatctgtgctgaccccaagcag
aagtgggtccaggatgccattgccaacctggacaagaaaatgcagacaccaaagactttg
acctcttattccacaacccaagaacacacgactaatttatcttccacccggacaccctct
actactacttcattgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100343840
Entry
100343840         CDS       T03373                                 
Symbol
CCL7
Name
(RefSeq) chemokine (C-C motif) ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100343840 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100343840 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100343840 (CCL7)
   04062 Chemokine signaling pathway
    100343840 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100343840 (CCL7)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100343840 (CCL7)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100343840
NCBI-ProteinID: NP_001284411
UniProt: J7I290
LinkDB
Position
19:23731547..23733738
AA seq 99 aa
MQISAALLCLLLTVAAFSSQVLAQPEGTNSGKTCCYRFHNRRMDPQKLRSYTLISISYCP
REAVIFKTKQHREVCADPKWPWAQNAIAYLNKKTQTSKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcaaatctctgcrgcacttctgtgcctgctgctcacagtggctgccttcagctcccag
gtgcttgcccagccagaagggactaacagcggcaaaacctgctgctacagattccacaac
aggaggatggacccgcagaagctgaggagctacacactcatcagcatcagctactgtccc
cgggaagctgtgatcttcaagaccaaacagcaccgagaggtctgtgctgaccccaagtgg
ccatgggcccaaaatgccattgcctacctgaacaagaaaactcagacttcaaagccttga

KEGG   Oryctolagus cuniculus (rabbit): 100348869
Entry
100348869         CDS       T03373                                 
Symbol
CCL27
Name
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348869 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348869 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100348869 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348869 (CCL27)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348869 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348869
NCBI-ProteinID: XP_002707984
Ensembl: ENSOCUG00000001224
UniProt: A0A5F9CTF0
LinkDB
Position
1:19161806..19163369
AA seq 121 aa
MEGCSPTSRLLLLLLLLSLDPGAVLILPPSTTCCTQLYRQPLSNKLLRKVIRVELQEADG
DCHLQAFVLHLARRSVCIHPQNRSLARWFERQGKRLQGTQPDFWVARENGLEPHKAPIKQ
H
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggggtgttcacctaccagcaggctcctgctgctgctgttgctcctgagcctggac
cctggagcagtgttgatactgccacccagcactacctgctgtactcagctctaccgacag
ccactgtcaaacaagctactgaggaaggtcatccgggtggaactgcaggaggctgatgga
gactgtcacctgcaggctttcgtgcttcatctggctcgacgcagcgtgtgcattcatccc
cagaaccgcagcctggctcggtggttcgagcgccaagggaagaggctccaggggactcaa
cctgatttctgggttgctagggaaaatgggttggagccccacaaagccccaataaagcaa
cattag

KEGG   Oryctolagus cuniculus (rabbit): 108176349
Entry
108176349         CDS       T03373                                 
Name
(RefSeq) uncharacterized LOC108176349
  KO
K16598  C-C motif chemokine 27
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108176349
   04061 Viral protein interaction with cytokine and cytokine receptor
    108176349
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    108176349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    108176349
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   108176349
SSDB
Other DBs
NCBI-GeneID: 108176349
NCBI-ProteinID: XP_017196196
UniProt: A0A5F9CL27
LinkDB
Position
1:19158512..19159459
AA seq 87 aa
MPGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPREQKLEPLRGLMSCLSSGLG
PAPSRSGRGLHCRTPAAAAQAAGALKI
NT seq 264 nt   +upstreamnt  +downstreamnt
atgccgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggc
tgtttctactttttcccctggctgcgaatgtggcggagagaacgaagttctgcacacccg
cgggagcagaagctggagcctctgcggggtctaatgagctgtctgtcgagcggcctgggc
cctgctccctcgcgttccggtcgtggcctccattgccgcactcccgccgccgctgcccag
gcagccggtgcattaaagatttaa

DBGET integrated database retrieval system