Oryctolagus cuniculus (rabbit): 100009130 Help Entry 100009130         CDS       T03373                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2 precursor   KO K14624   C-C motif chemokine 2 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04668   TNF signaling pathway ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05135   Yersinia infection ocu05142   Chagas disease ocu05144   Malaria ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05168   Herpes simplex virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05323   Rheumatoid arthritis ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100009130 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100009130 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     100009130 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100009130 (CCL2)    04657 IL-17 signaling pathway     100009130 (CCL2)    04062 Chemokine signaling pathway     100009130 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100009130 (CCL2)    05164 Influenza A     100009130 (CCL2)    05168 Herpes simplex virus 1 infection     100009130 (CCL2)    05163 Human cytomegalovirus infection     100009130 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     100009130 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     100009130 (CCL2)    05142 Chagas disease     100009130 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     100009130 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100009130 (CCL2)    05418 Fluid shear stress and atherosclerosis     100009130 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100009130 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100009130 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100009130 (CCL2) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    100009130 (CCL2) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Chemokines    100009130 (CCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100009130 NCBI-ProteinID:  NP_001075763 Ensembl:  ENSOCUG00000021710 UniProt:  P28292 LinkDB All DBs Position 19:21296100..21297759 Genome browser AA seq 125 aa AA seqDB search MKVSATLLCLLLIAVAFSSHVLAQPDAVNSPVTCCYTFTNKTISVKRLMSYRRINSTKCP KEAVIFMTKLAKGICADPKQKWVQDAIANLDKKMQTPKTLTSYSTTQEHTTNLSSTRTPS TTTSL NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcaacgcttctgtgcctgctgctcatagcagtcgccttcagctcccat gtgcttgcccagccagatgccgtgaattccccagtcacctgctgctatacattcaccaac aagaccatctcagtgaagaggctaatgagctatagaagaatcaacagcaccaagtgtccc aaagaagctgtgatcttcatgaccaaactggccaaggggatctgtgctgaccccaagcag aagtgggtccaggatgccattgccaacctggacaagaaaatgcagacaccaaagactttg acctcttattccacaacccaagaacacacgactaatttatcttccacccggacaccctct actactacttcattgtaa

Oryctolagus cuniculus (rabbit): 100343840 Help Entry 100343840         CDS       T03373                                  Symbol CCL7 Name (RefSeq) C-C motif chemokine 7 precursor   KO K05509   C-C motif chemokine 7 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100343840 (CCL7)    04061 Viral protein interaction with cytokine and cytokine receptor     100343840 (CCL7)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     100343840 (CCL7)    04062 Chemokine signaling pathway     100343840 (CCL7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100343840 (CCL7) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    100343840 (CCL7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 GPR15L Motif Other DBs NCBI-GeneID:  100343840 NCBI-ProteinID:  NP_001284411 UniProt:  J7I290 LinkDB All DBs Position 19:21307379..21309571 Genome browser AA seq 99 aa AA seqDB search MQISAALLCLLLTVAAFSSQVLAQPEGTNSGKTCCYRFHNRRMDPQKLRSYTLISISYCP REAVIFKTKQHREVCADPKWPWAQNAIAYLNKKTQTSKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcaaatctctgcrgcacttctgtgcctgctgctcacagtggctgccttcagctcccag gtgcttgcccagccagaagggactaacagcggcaaaacctgctgctacagattccacaac aggaggatggacccgcagaagctgaggagctacacactcatcagcatcagctactgtccc cgggaagctgtgatcttcaagaccaaacagcaccgagaggtctgtgctgaccccaagtgg ccatgggcccaaaatgccattgcctacctgaacaagaaaactcagacttcaaagccttga

Oryctolagus cuniculus (rabbit): 100348869 Help Entry 100348869         CDS       T03373                                  Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100348869    04061 Viral protein interaction with cytokine and cytokine receptor     100348869  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100348869  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100348869 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    100348869 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100348869 NCBI-ProteinID:  XP_002707984 Ensembl:  ENSOCUG00000001224 UniProt:  A0A5F9CTF0 LinkDB All DBs Position 1:33291036..33293159 Genome browser AA seq 121 aa AA seqDB search MEGCSPTSRLLLLLLLLSLDPGAVLILPPSTTCCTQLYRQPLSNKLLRKVIRVELQEADG DCHLQAFVLHLARRSVCIHPQNRSLARWFERQGKRLQGTQPDFWVARENGLEPHKAPIKQ H NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggaggggtgttcacctaccagcaggctcctgctgctgctgttgctcctgagcctggac cctggagcagtgttgatactgccacccagcactacctgctgtactcagctctaccgacag ccactgtcaaacaagctactgaggaaggtcatccgggtggaactgcaggaggctgatgga gactgtcacctgcaggctttcgtgcttcatctggctcgacgcagcgtgtgcattcatccc cagaaccgcagcctggctcggtggttcgagcgccaagggaagaggctccaggggactcaa cctgatttctgggttgctagggaaaatgggttggagccccacaaagccccaataaagcaa cattag

Oryctolagus cuniculus (rabbit): 108176349 Help Entry 108176349         CDS       T03373                                  Name (RefSeq) uncharacterized protein LOC108176349   KO K16598   C-C motif chemokine 27 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108176349    04061 Viral protein interaction with cytokine and cytokine receptor     108176349  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     108176349  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     108176349 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Chemokines    108176349 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  108176349 NCBI-ProteinID:  XP_017196196 Ensembl:  ENSOCUG00000001224 UniProt:  A0A5F9CL27 LinkDB All DBs Position 1:33288251..33289249 Genome browser AA seq 87 aa AA seqDB search MPGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPREQKLEPLRGLMSCLSSGLG PAPSRSGRGLHCRTPAAAAQAAGALKI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgccgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggc tgtttctactttttcccctggctgcgaatgtggcggagagaacgaagttctgcacacccg cgggagcagaagctggagcctctgcggggtctaatgagctgtctgtcgagcggcctgggc cctgctccctcgcgttccggtcgtggcctccattgccgcactcccgccgccgctgcccag gcagccggtgcattaaagatttaa

DBGET integrated database retrieval system